KEGG   Vibrio cholerae O1 MJ-1236: VCD_002678Help
Entry
VCD_002678        CDS       T00903                                 

Definition
(GenBank) intracellular septation protein A
  KO
K06190  intracellular septation protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    VCD_002678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IspA YbjM
Motif
Other DBs
NCBI-ProteinID: ACQ60842
Position
1:complement(1833784..1834329)
Genome map
AA seq 181 aa AA seqDB search
MKQLLDFIPLIIFFALYKFYDIYVATGALIAATTVQVIVTYAMYKKVEKMQLITFVMVAL
FGGMTLALHDDNFIKWKVTIVYVVFALGLTISQIMGKPAIKGMLGKELTLPDAVWSTINW
AWVMFFSGCAALNLYVAYHLPLDVWVNFKVFGLLAATLVFTLLTGGYIYKHLPHEPKQKN
Q
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaactgctcgactttattccactgatcatttttttcgctttatataagttttat
gacatctacgtagcaacaggggcgctgatcgccgccacaacggttcaagtgattgtcact
tatgctatgtacaaaaaagtggagaaaatgcagctcatcacattcgtgatggttgctctg
tttggtggcatgaccttagccctgcatgacgataacttcatcaaatggaaagtgacgatt
gtgtatgtggtttttgcgctcggtctaaccatcagccagatcatgggtaagcctgcgatc
aaagggatgctcggtaaagagctcaccttgccggatgcggtatggtcaaccattaactgg
gcatgggtgatgtttttcagcggctgcgctgcactcaatctttatgttgcctaccaccta
ccgcttgatgtctgggtcaatttcaaggtatttggtctgttggcggcaaccttagtgttt
actctgctcacgggaggctacatctacaaacaccttccccatgaacccaaacagaaaaac
caataa

DBGET integrated database retrieval system