KEGG   Vibrio cholerae O1 MJ-1236: VCD_002680Help
Entry
VCD_002680        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF218 AAA_33
Motif
Other DBs
NCBI-ProteinID: ACQ60844
Position
1:complement(1834964..1835611)
Genome map
AA seq 215 aa AA seqDB search
MSKRLYQQIETLWDYLQLHQQPNVADLILVLGSNDVRVAEHAAKLYHQGLAPYVLFSGGF
GRFTQGVFNHNEAETFAAIAKDAGVPEHAILLETQSTNSGENLHFSHQLLVQQARPAKRI
LLVQKPYMERRAYATFMQQWPESVESVQVTSPAGSFFDYLTSELTSDFVLNAMLGDFERI
RDYPALGFQITQPIPEPVMQAYQALLPLKVNLEMS
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacgcttgtatcaacagattgaaaccctttgggattacttgcagttgcaccaa
caacccaacgttgcggatctgattttggtgctcggcagtaacgatgtccgtgtggcagaa
catgcggcaaaactctaccaccaaggccttgccccttatgtactgttttctggtggcttt
ggccgttttactcaaggggtatttaaccacaatgaggcggagacttttgcagcgatcgcc
aaagatgctggtgtccctgaacacgcgattttgcttgagacacaatcgaccaatagtggt
gaaaatctacatttcagccatcagctattggtacaacaagctcggcctgccaaacgcatc
ttactggtgcaaaaaccttatatggaacgtcgcgcttatgcgacatttatgcaacagtgg
ccagaatcggtcgaaagtgtgcaggttacctcacccgcaggcagtttttttgactattta
acttcagagctcaccagtgattttgtgctcaatgccatgctgggcgattttgaacgcatc
cgagattatccagcgctgggttttcaaatcacgcaacctatcccagagccagtgatgcag
gcctatcaagccttgttgccattaaaagtgaatcttgaaatgtcatga

DBGET integrated database retrieval system