KEGG   Vibrio cholerae O1 MJ-1236: VCD_002685Help
Entry
VCD_002685        CDS       T00903                                 

Definition
(GenBank) cytochrome c-type protein TorY
  KO
K03532  trimethylamine-N-oxide reductase (cytochrome c), cytochrome c-type subunit TorC
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VCD_002685
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vcj02000]
    VCD_002685
Transporters [BR:vcj02000]
 Other Transporters
  Transmembrane electron carriers [TC:5]
   VCD_002685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_NNT Cytochrome_C7 Cytochrom_c3_2 Paired_CXXCH_1 Cytochrom_CIII DHC Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: ACQ60849
Position
1:1838874..1840058
Genome map
AA seq 394 aa AA seqDB search
MKSLILKMWHTMTRPAVHISLGVLTLGGFIAGVIFWGGFNTALEATNTEEFCISCHTMRD
NVYQELQTTVHWKNHSGVRATCPDCHVPHEWTAKIARKMQASKEVFAQIFGDLDTPEKFE
ERRIELAKHEWDRFAANKSLECKNCHNYESMDFDQMSATARIQMKQAAERDQSCIDCHKG
IAHNLPKNMESSSGLIGELEGMASNTKYSNGETLVSVRFLPVYEDDQAKVEAGLLNPASE
VKVLTEKGDMMQVEINGWRKSKGFGRVIQEDFGMNIAVASLLKEAAMSDAIVTTGEQKVD
DMTGLPWEQVSAKVWMKKEAMLNDINPVWEKAREAYKTNCSVCHTQPDEAHFDANTWPGM
FDGMLAFVNFDTDSEALVLKYLQKHSSDFAEGHH
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgttaattttaaaaatgtggcacaccatgacgcgtcccgcggtacacattagc
ttgggggtattgactctcggtggctttatcgctggggtaattttctggggcggctttaac
accgctttggaagcgaccaacacggaagagttctgtatcagttgtcacaccatgcgtgac
aacgtgtaccaagagctgcaaaccacagtgcactggaaaaaccactctggcgtgcgagcg
acctgtcctgattgtcacgtcccgcatgagtggacggcgaaaattgcacgtaagatgcaa
gcttcaaaagaagtattcgcacagatctttggtgatttagatacgccagaaaagtttgaa
gagcgccgaattgaattggcaaaacacgaatgggatcgctttgcggcgaacaaatctctg
gagtgtaaaaactgccataactacgaatcgatggattttgaccagatgtccgcaacggcg
cgtatccaaatgaagcaagcggcagagcgcgatcaaagctgtatcgattgtcacaagggg
attgcccacaacttgccgaaaaacatggagagctcaagcggcttgattggtgagctcgaa
ggtatggcatccaacaccaaatactccaatggtgaaaccttagtcagcgtgcgtttcctc
cctgtgtatgaagatgatcaagccaaagtggaagcgggtctactcaaccctgcttctgaa
gtgaaagtgctgactgaaaaaggcgacatgatgcaagtggagatcaacggctggcgtaaa
tcgaaaggctttggccgtgtgatccaagaagatttcggtatgaacatcgcggtggcgtcg
ctactgaaagaggccgccatgtcggatgcgattgtgaccacgggtgagcagaaagtcgat
gacatgacgggtctaccttgggagcaagtcagcgcgaaagtgtggatgaaaaaagaagcc
atgctgaacgacatcaacccagtttgggaaaaagcgcgtgaagcttacaagaccaactgt
tctgtctgtcacacccaaccggatgaagcgcactttgatgccaacacttggcctggcatg
ttcgacggtatgttggcattcgtcaacttcgataccgacagtgaagcgctggtactgaag
tacctgcaaaaacactcttcagatttcgctgaaggccaccactaa

DBGET integrated database retrieval system