KEGG   Vibrio cholerae O1 MJ-1236: VCD_002696Help
Entry
VCD_002696        CDS       T00903                                 

Definition
(GenBank) peptide transport system permease protein SapB
  KO
K19227  cationic peptide transport system permease protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj01503  Cationic antimicrobial peptide (CAMP) resistance
vcj02010  ABC transporters
Module
vcj_M00739  Cationic peptide transport system
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VCD_002696
 09160 Human Diseases
  09168 Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    VCD_002696
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vcj02000]
    VCD_002696
Transporters [BR:vcj02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Cationic peptide transporter [MD:M00739] [OT]
    VCD_002696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACQ60860
Position
1:complement(1850836..1851798)
Genome map
AA seq 320 aa AA seqDB search
MFVYTVRKFNLFIITLLILTMVGYSLARFDPHSPWTLIGFWQGWSSYLVQLMEFNFGLNK
NGVPILHELLVVFPATIELCTIAFILSLLVGIPIGTLAGMRQGKWLDTIISFISMSGYSA
PIFWLALMMIMAFSLHFPVFPVAGRYDLLYQIDHVTGFALIDAFLSQSPYRSQALQSVIE
HLTLPCLVLALAPTTQVIGQMRASVAEVMNQNYIRAAKIKGLSNYQIVTQHVLRNAIPPM
IPKFGVQLSSMLTLAIITESIFNWPGIGRWLLDALANRDFMSIQAGVIVVGTLVLTANIL
SDLIGAAANPLVRKEWYVKR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtctatacggtccgtaaatttaacttatttatcatcaccttgcttatcttgacc
atggtcggctacagcttagccagatttgacccgcactcgccttggacgctgatcggcttt
tggcaaggatggtcaagctatttggtgcaactgatggaattcaactttggcctcaataaa
aatggggtaccgattctccatgagttactggtggtatttccggccaccattgagctgtgt
accatcgcgtttatcctctctttgctcgtaggaattcctatcggaacactggcgggaatg
cgacaagggaaatggttagacactattatctcgttcatttcgatgtcgggatattctgcc
cctattttctggctggcgctgatgatgatcatggcgttttcactgcatttcccggtattt
cctgtggcgggacgctatgacttgctgtatcaaattgatcacgttaccggctttgccctg
attgatgcctttttgtctcaatccccctaccgcagccaagcgctgcaaagtgtgatagag
catttaacgctgccctgcttagtgctggcgctggcgccgaccacgcaagtcatcggccaa
atgcgcgcttcggttgccgaagtcatgaaccaaaactatatccgtgccgccaaaattaaa
ggcttgtctaactatcaaatcgtcactcagcacgttttacgcaatgcgattccgccgatg
atcccgaaatttggcgttcaactttccagcatgctgaccttagccattattactgaatcg
atctttaactggccgggtatcggccgttggttattggatgcattagccaaccgtgatttt
atgtcgattcaagcaggcgttatcgttgtcggtactctggtcttaacggccaatatcctc
tctgatttgattggcgcagcagctaaccccttggtaaggaaagagtggtatgttaagcga
tag

DBGET integrated database retrieval system