KEGG   Vibrio cholerae O1 MJ-1236: VCD_002697Help
Entry
VCD_002697        CDS       T00903                                 

Definition
(GenBank) peptide transport periplasmic protein SapA
  KO
K19226  cationic peptide transport system substrate-binding protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj01503  Cationic antimicrobial peptide (CAMP) resistance
vcj02010  ABC transporters
Module
vcj_M00739  Cationic peptide transport system
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    VCD_002697
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    VCD_002697
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vcj02000]
    VCD_002697
Transporters [BR:vcj02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Cationic peptide transporter [MD:M00739] [OT]
    VCD_002697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: ACQ60861
Position
1:complement(1851798..1853420)
Genome map
AA seq 540 aa AA seqDB search
MNALLRFTLGLCSMTLLAGCGENIDHSKIRSSGFVYCGESAPTTFNPQLADNDITSDALG
PQIYNTLLTIDPETHLPVASLASSWTVNSTGLEYVFKLRPDVAFQTTPWFSPTRPLNADD
VVFSFRRIIDPTNPYHKVGQTQYPWFKGIDFQNLLVDVSALDDLTVKFVLSRPDNSFLSN
IATSHAVILSLEYANQLIIDDEKEKLDNLPLGTGPFYLAEYHPRDLIRLKRHPQYWEGAA
KVEQVVFDISQRGTGMLAKLLRNECDVLNAPISSQLPAIEKNPDIVLQTTPAMNVAFIAV
NTQHPALNDNRVRKALNFAINRQNILDSVYYGTGSIAFTILPPTSWAYQQDTAQIRYDRN
YAQALLREAGFATGLELTMSVPVEPKAYNPSPRKTAELIQANLADIGVTLRLISEDRSER
QELSIRNNIDLYLSGWTGDTGDPDNFLRPLLSCDSNRAGLNVSMWCDSDFDFLLDLALEA
NKPRYRLNLYHQAQNILNQEFPVIPLAHGIQFTAYSKSLTGIRISPFNVQPFNTVERVAE
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcattattacgatttacgctagggctgtgcagcatgactctgctggcaggctgc
ggagaaaacatcgaccacagcaagatccgcagtagcggctttgtctactgtggtgaaagt
gcgccgaccacctttaatccgcagttggcggataacgatatcacctctgatgcactcggt
ccgcagatctacaacaccttgctgacaatagaccccgaaacacacttacccgttgccagt
ttagccagtagctggaccgtcaatagcaccggacttgagtatgtgtttaagctgcgtccc
gatgtcgcgtttcaaaccactccctggtttagcccgacacgtcccctcaatgccgatgac
gtcgtgttcagttttcgacgcattattgacccgaccaatccctaccacaaagtaggccaa
actcaatatccttggtttaaaggcattgattttcagaatctattggttgatgtcagcgcg
ctcgatgacttaaccgtaaagtttgtccttagccggcctgataacagttttttatccaac
atcgccactagccacgcggtgattctgtcgttggaatacgccaatcagctcatcattgat
gatgaaaaagagaagctggataaccttcctctgggtactgggcctttttaccttgccgaa
taccatccgcgcgatttaattcgcttgaaacgtcatccccaatattgggaaggtgcggca
aaagtcgagcaagtggtgtttgatatttcacaacgtgggactggcatgctggccaaattg
ctgcgcaatgaatgtgatgtgctcaatgcaccgatttccagccaactgcctgcgattgaa
aagaacccagatattgtgctgcaaaccacacctgcgatgaatgtggcctttatcgcggtg
aacactcaacatcctgcgttaaatgacaatcgcgtgcgtaaagcactcaatttcgcgatt
aatcgacaaaatatcttggattctgtctattacggtaccggaagcatcgcttttaccatc
ttgccccccacctcttgggcctatcagcaagatacggcgcagattcgctacgatcgtaac
tacgcgcaagctttgctgcgtgaagctggatttgcaacgggtctggagctgaccatgtca
gtacctgtagagccgaaagcgtacaatcctagcccgcgcaaaacggcagagctgatccaa
gcgaatctcgccgacattggggtgacattacgcctcatcagtgaagatcgctcagagcgc
caagagctgagtatacgcaacaatattgacctgtacttaagtggctggacgggagatacg
ggtgacccagataacttcttacgccccttactctcttgtgattccaaccgcgcaggtctc
aacgtttccatgtggtgcgacagtgattttgattttctgttggacttggcgctagaagcc
aataaaccgcgctatcgcctcaatctgtatcatcaggcgcaaaatatcctcaatcaggag
tttccggtgattcctctcgcccacggcatacagtttaccgcttatagcaaatcattaacg
ggcattcgcattagtccatttaatgtccaaccgtttaatactgtcgagagggtggccgag
taa

DBGET integrated database retrieval system