KEGG   Vibrio cholerae O1 MJ-1236: VCD_002698Help
Entry
VCD_002698        CDS       T00903                                 

Definition
(GenBank) Psp operon transcriptional activator
  KO
K03974  psp operon transcriptional activator
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vcj03000]
    VCD_002698
Transcription factors [BR:vcj03000]
 Prokaryotic Type
  Other transcription factors
   Others
    VCD_002698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma54_activat Sigma54_activ_2 AAA_5 AAA_2 HTH_8 Mg_chelatase AAA AAA_16 AAA_7
Motif
Other DBs
NCBI-ProteinID: ACQ60862
Position
1:complement(1853534..1854550)
Genome map
AA seq 338 aa AA seqDB search
MQQSLLGESPAFLAVLDKVSRLAPIDRPVLVIGERGTGKELIAQRLHYLSKRWEQPLVSL
NCSTLSEGLIDSELFGHESGSFTGAKGRHQGRFERAEGGTLFLDELATAPLSVQEKLLRV
IEYGQYERVGGNQVLNANVRLVCATNANLPQMAQQGTFRADLLDRLAFDVIHLPALRHRP
EDIALLAEHFAIRMCRELQLPLFVGFSPNALHQLQAYSWPGNVRELKNVVERAVYQHGLN
SQPIDQLVFNPFQSSDIVTDESEQVDVRHTTRTDFHLPLDYKAWQQQCDIELLQAALTQA
KFNQKHAAQLLGLSYHQFRGMMRKYPQMNSENASPHVE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagagcttgctcggagagtcacctgcgtttttagcggtgttagacaaagtctca
cgtttagcgccgatcgatcgtcctgtgctggtcattggcgagcgcggaacgggtaaagag
ttgatcgcccagcgcttgcactatttatcaaaacgttgggaacaaccgctggtgtcgcta
aactgctcgacgctcagtgaaggactgatcgattcagagctgtttggccatgagtcaggc
tcgtttactggagccaaaggacgccatcaaggacgttttgaacgtgccgaaggcggtacg
ctgtttttagatgaattggccactgcaccactctcagtgcaagaaaaactgctacgcgtg
atcgaatacggccaatatgaacgtgtcggtggtaaccaagtattaaacgcgaatgtgcgc
ttggtatgtgcaaccaacgcgaatttaccgcaaatggctcagcaaggcacatttcgcgca
gacttactggaccgactggcgtttgacgtgattcatttgcccgcacttcgccatcggcca
gaagatattgcgctgcttgccgaacattttgctattcgcatgtgccgtgaactacaactg
ccactctttgttggctttagccccaatgcattacaccaactgcaagcctactcttggccg
ggcaatgtgcgtgagctgaaaaacgtggtggagcgcgcggtgtatcaacatgggttgaat
agccaaccaattgatcagttagtctttaacccgttccaatccagtgacattgtcaccgat
gagtctgagcaggttgacgttcgccataccactcgtaccgacttccatttgcctcttgac
tacaaggcatggcagcaacagtgtgatattgagttgttacaagcggcactcacgcaagcg
aaatttaatcaaaagcacgccgcgcagttgctgggactcagctatcatcaatttcgaggc
atgatgagaaagtacccacaaatgaacagtgaaaacgcctcgcctcacgttgagtga

DBGET integrated database retrieval system