KEGG   Vibrio cholerae O1 MJ-1236: VCD_002701Help
Entry
VCD_002701        CDS       T00903                                 

Definition
(GenBank) phage shock protein C
  KO
K03973  phage shock protein C
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vcj03000]
    VCD_002701
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic Defense System [BR:vcj02048]
    VCD_002701
Transcription factors [BR:vcj03000]
 Prokaryotic Type
  Other transcription factors
   Others
    VCD_002701
Prokaryotic defense system [BR:vcj02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   PspC-PspB
    VCD_002701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PspC Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: ACQ60865
Position
1:1855641..1856057
Genome map
AA seq 138 aa AA seqDB search
MKPQTGEIAMSKRELYRDPYNGKIAGVCAGLANYFGLEVWLVRILVITAALLGGTFLVLV
AYVAMALMLEKLPKQYREDIRSQQAHTLKSKPWAQGQAPKELLHTLDRDLSQVESRIRGV
EAYVTSEAFKVNREFRKL
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccccaaactggagaaatcgctatgagtaaacgcgagctgtaccgcgacccatat
aacggcaaaatagcgggggtttgtgcagggttagcgaattacttcggcctagaggtttgg
ctggtgcgaattttagtgatcaccgcagccttgctgggtgggacgtttttagtgctggtc
gcttatgtggccatggctctgatgctggagaagctaccgaagcagtaccgcgaagatatt
cgtagtcagcaagcgcatacgctgaaaagcaaaccttgggcacaagggcaagcaccaaaa
gagctgttgcacacgctagatcgcgatctcagccaagtcgagagtcgaattcgtggtgtg
gaggcgtatgtcacctccgaagcgtttaaggtcaaccgcgagtttcgcaaactctag

DBGET integrated database retrieval system