KEGG   Vibrio cholerae O1 MJ-1236: VCD_002703Help
Entry
VCD_002703        CDS       T00903                                 

Definition
(GenBank) hypothetical protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl_2 HlyD_3 HlyD_D23 Biotin_lipoyl Peptidase_M23 Lep_receptor_Ig
Motif
Other DBs
NCBI-ProteinID: ACQ60867
Position
1:1857262..1858341
Genome map
AA seq 359 aa AA seqDB search
MKIIRYTAWLAHLLLIAGCSEPTKLERDTLPRVKVAQAGEKVSDKLFFPAVANAAERSHL
SFRVAGEISKFHVKEGARVKQGDILAEIEPTDYRLAVDNAQARFSVIDSQYRRSQPLVEK
GLLAKSQFDEIAAQRQIARAELELAKLRLSFTQLRAPMDGIISRVSAEQFESVQVGQQIV
NIHNIDSVEVLIQLPDRLYATQPTASELAKIETVVRVPSGQVYPARIKEFTTEPDPATGT
FTVTLSLPMPEQELILDGMAVEVSAKGQHVGLNPLNTISIPIEAIFNADGDELDKTAQYV
WLLNNDNTVSKRQVRLAKASRSHVQVSEGINAGDRLVVAGVARLRDGMKVQVLEERGHE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataattcgttacaccgcttggttggctcacttactgttgatcgcaggatgcagt
gaacccacgaagctcgaacgcgatacgctaccgcgagtaaaggtggcgcaggcaggtgaa
aaagtcagtgataagctcttttttcctgcggtggccaatgcggctgaacgttctcatttg
agttttcgagtggcaggtgaaatcagtaagttccatgtcaaagagggcgctcgcgttaag
caaggcgacatcttggctgaaattgagccgaccgattaccgtttggctgtcgataatgct
caagcacgattttccgtgattgatagccaatatcggcgttcacaaccacttgtcgaaaaa
ggcttattagccaaatcacagtttgacgaaattgctgcgcagcgccaaatcgctcgtgct
gagcttgagttggcgaaacttcgtctctccttcacccaattacgcgcaccaatggatggc
atcatctcgcgtgtcagcgctgagcagtttgaaagtgttcaggttggccaacaaatcgtc
aatattcacaatatcgatagcgttgaagttttgattcaactgcctgatcgcctgtatgcg
acacaaccgacggccagcgagttggcgaagatagaaaccgtggtgcgtgtcccaagtggt
caagtttatcccgcacgtatcaaagaattcaccactgagccagaccctgccacggggaca
tttactgtcaccctttctctgcccatgccagagcaagaactgatcttggatggcatggct
gttgaagtgagtgccaaagggcaacatgtcgggctaaacccactcaataccatcagtatt
ccgattgaggcgatttttaatgcagacggtgatgagttagacaaaaccgctcaatacgtt
tggttgctcaacaacgacaatacggtgagcaaacgtcaggtgcggttagcgaaagcgtca
cgcagccatgttcaagtcagtgaaggaattaacgcgggagatcgtttagtggtcgctggc
gttgcaagattgagagatggaatgaaagtacaagtccttgaggagcgtggccatgagtga

DBGET integrated database retrieval system