KEGG   Vibrio cholerae O1 MJ-1236: VCD_002929
Entry
VCD_002929        CDS       T00903                                 

Definition
(GenBank) lipase family protein
Organism
vcj  Vibrio cholerae O1 MJ-1236
SSDB
Motif
Pfam: Lipase_3 CarboxypepD_reg SdrD_B
Other DBs
NCBI-ProteinID: ACQ61089
Position
1:complement(2127535..2129460)
AA seq 641 aa
MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKI
AAGEWRASVSQASLLTEVEKYASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWD
EAPKDEFLQKQHKGIDVNASAEKAGFRLSHNQTYVFEIKALRSYMPVIIDTDEFNLVNSY
TFALLSKLAYATNDFNRDDGKTIDNQGAISTVISQLKRKERPTYSGDLQAKWLLEEIPYS
KALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSKKPPVDNTKFKIIKAASGMAA
VIADKIESATDSPGMKDLIITDLDAAQIAPEEFGGTYVHRGFYQYTMALLSLMEKDLGLH
KIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGMPRVGTRSFVERYQNILHYRH
VNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTY
NSNNQVLLTPKQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQYIPNLFEQLTALS
DESLMVHYQRAISALEQEIATLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLI
ENRNKIRGELRQIVSDPQRMPATKFLISQQTLPDEIKVQIR
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggattcatttaattattgcgtgcagtgtaaccctgaggaaaactggttagagctagag
tttcggagtgaaaatgatgaaccgatagatggtttgctagttacgattacgaaccaaagt
gccccctctaacacatacacgcaaaccacaagttcgggtaaggtgttgtttggcaagatt
gcggctggggaatggcgtgcttctgtaagccaagcttctctgttaactgaagtcgaaaaa
tatgccagccgtaaagagggacaagagtcgccagtgaaaaaacgagctgcggcagaactt
gacgccgcagataaagatacgaagcagtaccgctttaccactattggtgatttctgggat
gaagcaccaaaagatgagtttttacaaaagcagcataaagggatagatgtcaatgcttct
gctgagaaagcagggtttagactcagtcataaccagacctatgtttttgaaatcaaagca
ctacgtagctatatgccagtgattattgataccgatgaatttaacttggtgaatagttat
acctttgcgttgttgtcgaaattagcttatgcgactaacgattttaatagggatgatggt
aagacaatagataatcagggagcaattagcacggttatttctcaattgaagcgtaaagaa
agaccgacttattctggagatttacaagcaaagtggttattagaggaaattccatatagc
aaagcgttaagtgcccaatattatgctgaggatgatgtcggtagtgaaggttacatcatc
tttaacgatgaattggcgattataggtgtgagaggtacagagccttattttcagagtaag
aaaccacctgttgataacactaaatttaaaattataaaagcggcttcaggtatggcggct
gtgattgcggataagatagaaagtgctaccgattcaccaggaatgaaagaccttattata
acagaccttgatgctgcgcaaatcgcccccgaagagtttggtggaacatatgttcatcgg
gggttttaccaatatacgatggctttgttatctttgatggagaaagatctagggctacat
aaaataaaaaaattctattgttgtggccatagcttagggggcgctggtgcattacttata
agtgcattgattaaagatagctatcatcctccagtattgcgtttatatacatatggaatg
ccacgagtgggaactcgcagttttgtagagcgctatcaaaatattttgcattaccgtcat
gttaataatcacgatttggtgccacagataccaacagtatggatgaacacagatgtatct
gaaggattccatgtacttgatgtatttaaaagccgtgttgatctgatgagaaaaatgctc
actgatgatgatgatgacaattatcaacaccatggtcatttgtctcagttactaacttat
aattcaaataaccaagtcttactgacacccaaacaaactcaagtcactatgctagaccta
gcaaatttagccactaatgattctgttgctatggtagatggtttatcagatgcctcaata
gtagagcatggaatggagcagtatatacccaatttatttgagcagttaacagcactaagt
gatgaaagtttaatggtgcattatcaacgagcgatttcagccttagagcaggaaattgct
acgttgcaacaaagttatcttacagttaaacaagcttggattgaatctataggaaatggc
acgccgactatgaatatcggacgtttgatgagtgaaatgcattctataaataaattaata
gagaaccgtaataaaattagaggtgagctaaggcagatagtctctgatcctcagcgtatg
cctgcaactaaatttttaatttcacagcaaaccttaccagatgaaatcaaggtgcaaata
agatga

DBGET integrated database retrieval system