KEGG   Vibrio cholerae MJ-1236: VCD_003209Help
Entry
VCD_003209        CDS       T00903                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
vcj  Vibrio cholerae MJ-1236
Pathway
vcj00340  Histidine metabolism
vcj01100  Metabolic pathways
vcj01110  Biosynthesis of secondary metabolites
vcj01230  Biosynthesis of amino acids
Module
vcj_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:vcj00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    VCD_003209
Enzymes [BR:vcj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     VCD_003209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACQ61369
Position
1:complement(2460327..2461622)
Genome map
AA seq 431 aa AA seqDB search
MRTVVWQSLSEAQQESILERPAITEGANITAAVAQVIAKVRSEGDAALFELTEKFDRVKP
ASLRVSREEMDAAAARLSETMKQALEQAYNNISKFHKAQKAQPIKVETMPGVVCEQVTRP
INKVGLYIPGGSAPLPSTVLMLGVPAQIAGCRKVVLCSPPPIADEILYVAKLCNIDEVYN
LGGGQAIAAMAYGTETVTKVDKIFGPGNAYVTEAKRQVSNDFRGAAIDMPAGPSEVLVIA
DETADANFIAADLLSQAEHGPDSQVVLVTPSPVLADQVTDAVQKQLKVLSRASIAEKALA
SSLIIIAESLTQAVSISNYYGPEHLIVQTRNPRELVPLLDNAGSIFLGDWSPESVGDYAS
GTNHVLPTYGYTRTYSSLGLADFSKRMTVQELTADGLQLLAPTVVTMAEAEGLDAHKRAV
TIRVEKLQKAQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccgtggtttggcaatcgttgagtgaagctcagcaagaatcgattttagaacgt
cctgcgattaccgaaggagcaaacatcactgccgcagttgcgcaggtgattgcgaaagtg
cgcagtgagggtgatgccgcactgtttgaattaactgaaaaatttgatcgtgtaaaaccc
gcttcactgcgcgtatctcgcgaagagatggatgccgcggccgcgcgtttgtcggaaaca
atgaaacaggcgttggagcaggcatacaacaacatcagcaaattccacaaggcgcaaaaa
gcgcaaccaatcaaagtggaaaccatgcccggagtggtgtgtgagcaagtcactcgtccg
atcaacaaagtgggtctgtatattccgggtggcagcgcaccgctaccatcaaccgtacta
atgctcggtgtgcctgcgcaaatcgctggttgtcgtaaagtggtgctctgctcacctccg
ccaattgctgatgaaattctctacgtcgctaagctgtgtaacatcgatgaggtgtacaac
ctaggcggcggtcaggcaatcgccgcaatggcttacggtacggaaacggtgactaaagtt
gacaaaatctttggccccggtaacgcctatgtgacggaagcaaaacgccaagtgagtaac
gatttccgtggcgcagcgattgatatgcctgcaggaccttcagaagtattggtgattgct
gatgaaacggcggatgccaattttatcgccgccgatctactcagtcaggcagagcacggc
ccagattcacaggtggttctggtcacaccatcaccagtgttggccgatcaagtgacggac
gcagtgcaaaagcagcttaaagtgctttcgcgcgccagcattgctgaaaaagccttggct
tccagtctgatcattattgctgaatcactcacccaagcagtgtcgatttctaactactac
ggccctgagcacttgattgtgcagacgcgcaacccgcgtgagttggttccactgctcgat
aacgcaggctccattttccttggcgattggtcgccagaatcggtaggcgattacgcttct
ggtaccaaccatgtgctacccacttacggttacacccgcacctattccagcttaggtttg
gccgatttcagtaaacgcatgacagtgcaagagctgaccgctgatggcttgcaattgctt
gcgcccaccgtagtaacgatggcggaagcggaagggttagacgcgcacaaacgtgcggtt
acgattcgagtagaaaaattacagaaggctcaataa

DBGET integrated database retrieval system