KEGG   Vibrio cholerae O1 MJ-1236: VCD_003532Help
Entry
VCD_003532        CDS       T00903                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vcj  Vibrio cholerae O1 MJ-1236
Pathway
vcj00620  Pyruvate metabolism
vcj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VCD_003532
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vcj02000]
    VCD_003532
Enzymes [BR:vcj01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     VCD_003532
Transporters [BR:vcj02000]
 Other transporters
  Primary active transporters [TC:3]
   VCD_003532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ACQ61688
Structure
PDB: 

Position
1:2812633..2814432
Genome map
AA seq 599 aa AA seqDB search
MTQAIKRVGVTDVVLRDAHQSLFATRLRIDDMLPIAQQLDQIGYWSLECWGGATFDSCIR
FLGEDPWQRLRLLKQAMPNTPLQMLLRGQNLLGYRHYADDVVDTFVERAVKNGMDVFRVF
DAMNDVRNMQQALQAVKKMGAHAQGTLCYTTSPVHNLQTWVDVAQQLAELGVDSIALKDM
AGILTPYAAEELVSTLKKQVDVELHLHCHSTAGLADMTLLKAIEAGVDRVDTAISSMSGT
YGHPATESLVATLQGTGYDTGLDIAKLEQIAAYFRDVRKKYHAFEGMMKGSDARILVAQV
PGGMLTNMESQLKQQNALDKLDLVLEEIPHVREELGFLPLVTPTSQIVGTQAVINVVLGE
RYKTITKETSGVLKGEYGKTPAPVNTELQARVLAGAEAITCRPADLIAAEMPTLQDRVLQ
QAKEQYITLAENAIDDVLTIALFDQVGWKFLANRHNPEAFEPAPQAISSACAPKAPTEKS
KVQPVESHGVYTITVNNQSYVVKVDEGGDLTHVAPTASTNHAPVPSAAEGENLAAPLSGN
IWKIHASAGDEVAEGDVLLILEAMKMETEIRAPRAGVISAIEVNEGDAVQVGDALLVLA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcgatcaaacgcgttggtgttacggatgtcgtattgcgcgatgcgcaccaa
tctctttttgccacccgtttacgaattgacgacatgctgccgattgcgcagcaattagat
cagatcggctattggtctttggaatgttggggaggcgcgacctttgacagctgcatccgc
tttttaggcgaagacccatggcaacgcctacgtttactcaaacaagccatgcccaatacg
ccactgcaaatgctgctgcgcgggcaaaacctgcttggctaccgccactatgccgatgat
gtagtggatacttttgtggagcgtgcggtgaaaaacggcatggatgtatttcgtgtcttc
gatgcgatgaacgatgtacgcaacatgcaacaggcgctgcaagcggtgaaaaagatgggc
gcgcatgcgcaaggcacgctctgctacaccactagcccagtacacaatttacaaacttgg
gtcgatgtggcgcagcaactggctgagcttggtgtcgactcaattgccctgaaagatatg
gccggcattttgaccccgtatgccgctgaagagctggtgtctaccctgaaaaaacaagtg
gatgtcgagctgcatctgcactgccactccaccgctggccttgccgatatgactctgctt
aaagcaattgaagcaggcgtggatcgagtggataccgcgatttccagcatgagtggcact
tatggtcatccggcgaccgaatcactggttgcaaccttacaaggcacgggctacgacacc
ggattggatattgccaaactcgaacagattgcggcttacttccgtgatgtacgcaaaaaa
taccacgcctttgaaggcatgatgaaaggcagtgatgcgcgcattttggtggctcaggtt
ccgggcggcatgctaaccaacatggaaagccagctcaaacaacaaaacgcgctggataaa
ctcgatttagtgcttgaagagatcccacacgtacgtgaagaactcggctttttgcctctg
gtcacccctacctcacaaattgtcggtacacaagcggtaatcaacgtggtgctgggtgag
cgttacaaaaccatcaccaaggaaaccagcggtgtgctgaaaggagaatacggcaaaacg
ccagcaccggttaacactgagctgcaagctcgcgtgttggcgggcgcagaagccattact
tgtcgccctgcggatttgattgccgccgaaatgccaaccttgcaagaccgcgtattgcag
caagctaaagagcagtacatcaccctcgccgagaatgcgattgatgatgtactgaccatt
gcgctgtttgatcaggtaggctggaagtttttagccaaccgccataacccagaagccttt
gaacctgcgccgcaagcgataagttcagcctgcgcaccgaaagcgccaacagaaaaaagc
aaagtacagccagtggaaagtcacggtgtgtacaccattacggtgaacaaccaaagttat
gtggtgaaggtggatgaaggcggtgacctgacgcatgttgcgccgacggcatcaaccaac
cacgcaccagtcccgagtgccgcagaaggtgaaaacctcgccgcgccgctctctggcaac
atttggaaaattcatgcctcagccggtgatgaagtggccgaaggtgatgtcttgctgatt
ttagaagccatgaagatggaaaccgaaattcgcgcgccacgtgccggagtgatcagtgcc
attgaagtcaatgaaggcgatgccgtacaagtcggtgatgctttgttggtattggcgtaa

DBGET integrated database retrieval system