KEGG   Vibrio cholerae O1 MJ-1236: VCD_003669Help
Entry
VCD_003669        CDS       T00903                                 

Definition
(GenBank) IncF plasmid conjugative transfer pilus assembly protein TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
vcj  Vibrio cholerae O1 MJ-1236
Brite
KEGG Orthology (KO) [BR:vcj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcj02044]
    VCD_003669
Secretion system [BR:vcj02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   VCD_003669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraF AhpC-TSA Redoxin Thioredoxin_2
Motif
Other DBs
NCBI-ProteinID: ACQ61825
Position
1:complement(2969630..2970574)
Genome map
AA seq 314 aa AA seqDB search
MRTPLFPWFILWVTIPIIIFFLFILPAHASDGQFYQRGQEGWFWYQVIPEPAEDEEPIKP
ESGAAESSQSGLKPFSAAWFREHMQSFMDKAIDEPTTENVRAYLYLQRVMMDKGSLFADV
SQQVVMGDPVLDEISRRPLATYAANRMDREAGAQRDIALGEVAKRAGLFFFYRSDCPYCH
AQAPIIESMALNYGFEVFAIAVDGLPLPGGEFPNYKVDSGQAQSLSVTTVPAVFLVDPPN
VITPIGQGAMSLDELNNRIILAAHQAGWIDDQTYYATRPVQPGVSLAMSAQELNEKILQD
PEFLVRYLRAQGGL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagaacccccttgttcccttggttcatcctatgggtgaccatcccaatcattattttc
tttctattcatcctgcccgcccatgctagtgatgggcaattctatcagcgtggtcaggaa
ggctggttttggtatcaggtcattcctgagccagcggaggatgaagagcctataaagccg
gaatcaggtgcggcagagtcgagtcagagcgggctaaagcctttcagtgctgcttggttt
cgtgagcacatgcagtcgttcatggataaggcaattgatgagccgaccactgagaacgtc
cgagcctatctgtatcttcagcgcgttatgatggataagggctcactatttgctgatgtt
agtcagcaggttgtcatgggtgatcctgttttggatgaaatcagtcgcagacccttggct
acctatgctgccaatcggatggatcgagaagctggcgctcaacgagatattgctttaggt
gaagtagcaaaacgggctggcttgttcttcttctatcgttcggattgcccttactgccat
gctcaagcgcctatcatcgaatccatggctttgaactatggtttcgaggtgtttgctatt
gcagtcgatggcttgcctttacctggtggagagtttcctaattacaaagtcgattcagga
caagctcaatccttgtccgttacgactgtccctgccgtgttcttagttgatccgcctaat
gtcatcactccgattggccaaggcgcaatgagccttgatgagctcaataatcgaatcatt
cttgcagcccatcaagccggttggattgacgatcaaacttactatgccaccagacctgtt
caacccggcgtgtcactcgcgatgtcagcccaagagcttaacgaaaagatattacaggac
cctgagttccttgttcgctatctgcgtgcacaaggagggttataa

DBGET integrated database retrieval system