KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0097Help
Entry
VCLMA_A0097       CDS       T01871                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
vcl00860  Porphyrin and chlorophyll metabolism
vcl01100  Metabolic pathways
vcl01110  Biosynthesis of secondary metabolites
vcl01120  Microbial metabolism in diverse environments
Module
vcl_M00121  Heme biosynthesis, glutamate => heme
vcl_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VCLMA_A0097
Enzymes [BR:vcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     VCLMA_A0097
Exosome [BR:vcl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCLMA_A0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AEA77416
Position
I:100713..101636
Genome map
AA seq 307 aa AA seqDB search
MFILMGKDRRERVDSMPGVERLSIDLMLEEAQYLANLGVPAIALFPVVNQDAKSLCAAEA
YNPEGLVQRAVRALKEHVPQMGVITDVALDPFTTHGQDGIIDEQGYVLNDETTEVLVKQA
LSHAQAGADVVAPSDMMDGRIGRIRQALEEAGYIHTQIMAYSAKYASNYYGPFRDAVGSS
ANLKGGNKKNYQMDPANSDEALHEVAMDINEGADMVMVKPGMPYLDVVRRVKTELQVPTF
AYQVSGEYAMHKAAIMNGWLKERETVFESLLCFKRAGADGILTYFAKEVAEWLAEDSAKA
AQFLPKK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtttattttgatgggtaaagatcgccgtgaaagagtcgattccatgccgggcgtagaa
cgtttatccatcgatttaatgctggaagaagcacagtatctcgctaacctcggtgtgcct
gcgattgctctgtttcctgtggtcaatcaggatgcgaaaagcctatgtgcagcagaagct
tacaaccctgaaggcttagttcaacgcgcagtgcgtgcgctgaaagagcatgtgccgcaa
atgggcgtgatcactgatgtggcactggatccattcacaactcatggacaagacggcatc
atcgatgagcaaggttatgtgttgaatgatgaaacaacggaagtgctagtgaagcaagca
ctgtcgcatgctcaagctggcgcggatgtggttgccccttccgatatgatggatggccgt
attgggcgtattcgtcaagcattggaagaggcggggtacattcatactcaaatcatggct
tattccgctaaatatgcctcgaattactatgggccatttcgtgatgcggtcggttcatct
gcgaatttaaaaggtggcaacaagaagaactaccaaatggatcccgccaattccgatgaa
gctttgcatgaagtcgcgatggacatcaatgaaggcgcggacatggtgatggtgaagccc
ggcatgccctatctagatgtggtgcgccgtgtcaaaaccgagttgcaggtaccgaccttc
gcttaccaagtttccggtgagtatgcgatgcacaaagcggcaatcatgaatggttggttg
aaagagcgggaaacggtattcgaatctttactctgcttcaaacgtgcaggtgcagatggc
attttgacttactttgcgaaagaggtggctgagtggttggcggaagacagcgcaaaagct
gcgcaattcttacctaaaaaataa

DBGET integrated database retrieval system