KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0262Help
Entry
VCLMA_A0262       CDS       T01871                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
vcl00010  Glycolysis / Gluconeogenesis
vcl00620  Pyruvate metabolism
vcl00640  Propanoate metabolism
vcl00680  Methane metabolism
vcl01100  Metabolic pathways
vcl01110  Biosynthesis of secondary metabolites
vcl01120  Microbial metabolism in diverse environments
vcl01130  Biosynthesis of antibiotics
vcl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCLMA_A0262
   00620 Pyruvate metabolism
    VCLMA_A0262
   00640 Propanoate metabolism
    VCLMA_A0262
  Energy metabolism
   00680 Methane metabolism
    VCLMA_A0262
Enzymes [BR:vcl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     VCLMA_A0262
Lipid biosynthesis proteins [BR:vcl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   VCLMA_A0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEA77576
Position
I:complement(288091..290040)
Genome map
AA seq 649 aa AA seqDB search
MSEAHIYPVKQNIKAHTHADNDTYLAMYQQSIKDPEGFWSEHGKIVDWIKPFTKVKHTSF
DPGHIDIRWFEDGTLNVSANCIDRHLATRGDQVAIIWEGDDPTQDKTLTYKQLHQEVCRF
ANALKEQGVRKGDVVCIYMPMVPEAAVAMLACTRIGAVHTIVFGGFSPEALAGRIIDSNA
KLVITADEGVRGGRAVPLKKNVDEALCNPEVKNISKVMVLKRTGGNVAWHEHRDIWWHEA
TAKASDHCPPEEMKAEDPLFILYTSGSTGKPKGVLHTTGGYLVYATMTFKYVFDYQPNEV
FWCTADVGWITGHSYLVYGPLANGAKTILFEGVPNYPTTARMSEVVDKHKVNILYTAPTA
IRALMAKGDEAIKGTSRDSLRIMGSVGEPINPEAWEWYYRTIGNEKSPIVDTWWQTETGG
ILITPLPGATALKPGSATRPFFGVQPALVDNMGEIVEGATEGNLVLLDSWPGQMRTVYGD
HDRFEQTYFSTFKGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESALVAFN
KIAEAAVVGVPHDIKGQAIYAYITLNDGVYPSAELHKEVKDWVRKEIGAIATPDVLHWTD
ALPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVDRLIAEKAQLK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcccatatttatccggtcaaacagaacatcaaagcgcatacgcatgccgat
aacgacacctatctggcgatgtatcaacagtccatcaaagatccggaaggcttttggagc
gaacacggcaaaatcgtcgactggattaaacctttcaccaaggtgaaacacacctctttt
gacccagggcacatcgatatccgctggtttgaagatggcacgttaaacgtttctgccaac
tgtattgatcgccatttggcgacccgtggcgaccaagtcgcgatcatttgggaaggcgat
gacccaactcaagacaaaaccctgacgtataaacaactgcaccaagaagtgtgccgtttt
gccaatgcgctgaaagagcaaggcgtacgcaagggtgatgtcgtctgtatctacatgcct
atggtgccagaagcggcggttgctatgttggcctgtactcgcatcggcgcggtacacact
atcgtctttggtggcttctcaccggaagcactggcgggacgcattatcgactcgaacgcc
aaattagtgatcactgccgacgaaggtgttcgcggcggccgcgccgtccccctaaagaaa
aacgtcgatgaagcactgtgcaatccagaagtcaaaaacatcagtaaagtgatggttctt
aagcgtactggtggcaatgtcgcttggcatgaacaccgtgacatttggtggcatgaagca
accgcaaaagcgtctgaccactgcccaccagaagagatgaaagccgaagatccgctgttt
atcctctacacctctggctcaaccggtaaaccgaaaggcgtattgcacaccactggcggt
tatttggtttatgcgactatgaccttcaaatatgtattcgactatcagcccaatgaagtg
ttctggtgtaccgctgatgtgggttggataacaggtcactcctatctggtgtatggacca
ctggcgaatggcgcaaaaaccattctgtttgaaggcgtgccaaactaccccaccaccgca
cgcatgagtgaagtggtggataagcataaggtcaatatcctttacactgcgccaacggcg
atccgtgcgctgatggccaaaggtgatgaagcgattaaaggcactagccgtgacagcttg
cgcattatgggctctgtgggtgaaccgattaacccagaagcgtgggagtggtactaccgc
acgatcggtaacgaaaaatcaccgattgtcgatacttggtggcaaaccgaaaccggcggt
atcttgatcacgccactgccgggtgcaacggcgttgaaaccaggttcggccacacgcccc
ttctttggtgtgcagccagcgttagtcgataacatgggcgaaattgtggaaggtgcaact
gaaggcaacttggtgctgctcgattcatggccgggtcaaatgcgcactgtgtatggcgat
cacgaccgctttgaacaaacctacttctctacctttaaaggcatgtactttaccggtgac
ggcgcgcgtcgcgatgaagacggttactactggatcacaggccgtgtcgatgacgtactc
aacgtttcgggtcaccgtatgggaacggcagaaattgaatccgcactggtggcattcaat
aagattgcagaagccgccgtggtcggtgttccacacgatatcaaaggccaagcgatttac
gcttacatcacactcaatgatggggtgtatccgagcgctgaactgcataaagaagtgaaa
gattgggtacgcaaagagattggcgctatcgcgacaccggatgtcctacactggaccgat
gcgctaccgaaaacccgctcaggtaaaattatgcgccgtattttgcgtaaaattgccacc
ggcgataccagcaacttgggggatacctcaacgctggccgatccaagcgtggttgaccgc
ctgattgccgaaaaagcccaacttaaataa

DBGET integrated database retrieval system