KEGG   Vibrio cholerae LMA3984-4: VCLMA_A0353Help
Entry
VCLMA_A0353       CDS       T01871                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
vcl00040  Pentose and glucuronate interconversions
vcl00052  Galactose metabolism
vcl00500  Starch and sucrose metabolism
vcl00520  Amino sugar and nucleotide sugar metabolism
vcl01100  Metabolic pathways
vcl01130  Biosynthesis of antibiotics
Module
vcl_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VCLMA_A0353
   00052 Galactose metabolism
    VCLMA_A0353
   00500 Starch and sucrose metabolism
    VCLMA_A0353
   00520 Amino sugar and nucleotide sugar metabolism
    VCLMA_A0353
Enzymes [BR:vcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VCLMA_A0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 Smr
Motif
Other DBs
NCBI-ProteinID: AEA77660
Position
I:complement(403283..404089)
Genome map
AA seq 268 aa AA seqDB search
MPKEMMPVVNKPLIEYGVDEAIQAGITGMCIVTGRGKHSIMDHFDMNYELEHQIRGTNKE
ELLGDIRKIIESANFTFIRQREMKGLGHAILTGKELVGDEPFAVVLADDLCVNEEQGVLA
QMVALYKQFRCSIVAVQEVPENETHKYGVIAGEMIKDDLFRVDNMVEKPEPGTAPSNLAI
IGRYILTPDIFDLIEQTEPGKGGEIQITDALLKQAKSGCVLAYKFKGKRFDCGSVEGYIE
ATNFCYENMYKKNDQKVELAKKSTHKGQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggtgttgatgaa
gcgattcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaagcattcgatc
atggatcactttgacatgaactacgagttagagcaccaaatccgcggtacgaataaagaa
gagctattgggtgatatccgtaaaatcatcgaaagcgctaactttacttttattcgccaa
cgcgaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtcggtgatgag
ccgtttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggcgtactggca
cagatggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaagaggttcca
gaaaacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagacgatctgttc
cgcgtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaacctcgccatc
attggccgttatatcctcacgccagatatttttgatctgattgagcagaccgagccgggc
aaaggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaatcgggttgtgta
ctggcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggctatatcgaa
gccaccaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtggagttggct
aaaaagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system