KEGG   Vibrio cholerae LMA3984-4: VCLMA_A1022Help
Entry
VCLMA_A1022       CDS       T01871                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
vcl00260  Glycine, serine and threonine metabolism
vcl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vcl01100  Metabolic pathways
vcl01110  Biosynthesis of secondary metabolites
vcl01130  Biosynthesis of antibiotics
vcl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VCLMA_A1022
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VCLMA_A1022
Enzymes [BR:vcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VCLMA_A1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEA78279
Structure
PDB: 

Position
I:complement(1144254..1145060)
Genome map
AA seq 268 aa AA seqDB search
MNRYQALFQRLSTAQQGAFVPFVTIGDPNPEQSLAIMQTLIDAGADALELGMPFSDPLAD
GPTIQGANLRALAAKTTPDICFELIAQIRERNPETPIGLLMYANLVYARGIEDFYQRCQK
AGVDSVLIADVPTNESQPFVAAAEKFGIQPIFIAPPTASDETLRAVAQLGKGYTYLLSRA
GVTGAETKANMPVHALLERLQQFDAPPALLGFGISEPAQVKQAIEAGAAGAISGSAVVKI
IETHLDNPAKQLTELANFTQAMKKATKI
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttatcaagccctatttcaacgcctgagcacagcgcagcaaggcgctttcgtt
cctttcgtaacgattggtgacccaaaccccgagcagtcactcgccatcatgcaaaccctg
attgatgcaggagcggatgcgcttgagcttggcatgccgttttcagatcctctggccgat
ggcccgacgattcaaggcgcgaacttacgtgcattagcggcgaaaaccacgccagatatc
tgttttgagctgatcgcgcagattcgtgaacgtaaccctgagactccgattggtttactg
atgtatgccaacttggtttacgcacgcggcatcgaagatttttatcaacgctgccaaaaa
gctggagtggattcggtactgattgccgatgtacccaccaacgaaagccagccttttgtg
gcggccgcagagaaatttggcattcaaccaatctttattgcgccaccaacggccagtgat
gaaaccttacgggcagttgctcaactcggtaaaggctacacttatttgctttcgcgcgct
ggggtgactggggctgaaaccaaagccaacatgcctgtgcatgccctgcttgaacgtctg
caacaatttgatgcgccaccagcactgctaggttttggtatttcagagcccgctcaagtt
aaacaagcgattgaagctggcgcagcgggagccatttccggatcggcggtggtaaaaatc
atcgaaacgcatttggataatccagctaagcagctgactgagctggcaaacttcactcaa
gccatgaaaaaagcaacaaaaatttaa

DBGET integrated database retrieval system