KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_A2287Help
Entry
VCLMA_A2287       CDS       T01871                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Pathway
vcl03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    VCLMA_A2287
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vcl03011]
    VCLMA_A2287
Ribosome [BR:vcl03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    VCLMA_A2287
  Bacteria
    VCLMA_A2287
  Archaea
    VCLMA_A2287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEA79480
Position
I:complement(2592096..2592428)
Genome map
AA seq 110 aa AA seqDB search
MEAIAKHNFARISPQKARLVADQIRGKSVDQALELLTFSNKKAAELVKKVLESAIANAEH
NEGADIDDLRVAKIFVDEGPVMKRIMPRAKGRADRILKRSSHITVVVADR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagctatcgctaaacataactttgctcgtatttctcctcagaaagctcgcttagtt
gcagaccaaatccgcggtaaatctgtggatcaagcgctagaacttctgactttcagcaac
aaaaaagcggctgaactggttaagaaagttctggaatctgcaatcgcgaacgcagagcac
aacgaaggtgcagacatcgacgatctacgtgtcgctaaaatcttcgtagatgagggccca
gtcatgaagcgtattatgcctcgtgctaaaggccgtgcggatcgtatcttgaagcgttca
agccacattactgtggttgtcgcagatcgctaa

DBGET integrated database retrieval system