KEGG   Vibrio cholerae LMA3984-4: VCLMA_A2360Help
Entry
VCLMA_A2360       CDS       T01871                                 

Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vcl  Vibrio cholerae LMA3984-4
Pathway
vcl00010  Glycolysis / Gluconeogenesis
vcl00051  Fructose and mannose metabolism
vcl00562  Inositol phosphate metabolism
vcl01100  Metabolic pathways
vcl01110  Biosynthesis of secondary metabolites
vcl01120  Microbial metabolism in diverse environments
vcl01130  Biosynthesis of antibiotics
vcl01200  Carbon metabolism
vcl01230  Biosynthesis of amino acids
Module
vcl_M00002  Glycolysis, core module involving three-carbon compounds
vcl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vcl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCLMA_A2360
   00051 Fructose and mannose metabolism
    VCLMA_A2360
   00562 Inositol phosphate metabolism
    VCLMA_A2360
Enzymes [BR:vcl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VCLMA_A2360
Exosome [BR:vcl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VCLMA_A2360
  Exosomal proteins of bladder cancer cells
   VCLMA_A2360
  Exosomal proteins of melanoma cells
   VCLMA_A2360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Ntox27
Motif
Other DBs
NCBI-ProteinID: AEA79550
Position
I:2667884..2668657
Genome map
AA seq 257 aa AA seqDB search
MRRPVVMGNWKLNGSKAMVTDLLNGLNAELEGVAGVDVVVAPPAMYLDLAERLIKEGGNK
LILGAQNTDTHNSGAYTGDMSPAMLKDFGASHIIIGHSERRDYHKESDEFVAKKFAFLKE
NGLTPVFCIGETEAQNEAGETEAVCARQINAVIDAYGVEALNGAIIAYEPIWAIGTGKAA
TADDAQRIHASIRALIAAKDAAVAEQVIIQYGGSVKPENAASYFAQPDIDGALVGGASLD
AKGFAAIAKAAAEAKKA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgtcctgttgtgatgggtaactggaaactgaatggcagcaaagctatggtcact
gacctgctaaacggcttgaatgcagaacttgaaggtgttgcaggtgttgatgttgtcgtt
gcgccaccagcaatgtatttggatctggctgagcgcctgatcaaagaaggcggcaacaag
ctgatcctgggtgcacaaaacaccgatactcacaacagtggtgcgtacacaggtgatatg
tctcctgcgatgctgaaagatttcggtgcttcgcacatcatcatcggtcactctgagcgt
cgtgattaccacaaagaatcagatgagttcgtcgctaagaaatttgcgttcctgaaagaa
aacggcctaacgccagtcttctgtatcggtgaaactgaagcgcaaaacgaagcgggcgaa
acagaagcggtatgtgctcgccaaatcaacgcagtgatcgatgcttacggcgttgaagca
ctgaacggcgcgatcatcgcttacgaaccaatctgggcaatcggtacgggtaaagccgcg
acagcagatgatgcacagcgtatccacgcgtcaatccgtgcactgatcgcagcgaaagat
gctgcagtagcagagcaagtgatcatccagtacggcggttctgtaaaaccagaaaacgca
gcgtcttactttgcacaaccagacatcgacggtgcgctggttggcggtgcatcactggat
gcgaaaggctttgccgcgatcgccaaagccgcagcagaagcgaaaaaagcgtaa

DBGET integrated database retrieval system