KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_A2378Help
Entry
VCLMA_A2378       CDS       T01871                                 

Definition
(GenBank) Fructose-1,6-bisphosphatase, GlpX type
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Pathway
vcl00010  Glycolysis / Gluconeogenesis
vcl00030  Pentose phosphate pathway
vcl00051  Fructose and mannose metabolism
vcl00680  Methane metabolism
vcl01100  Metabolic pathways
vcl01110  Biosynthesis of secondary metabolites
vcl01120  Microbial metabolism in diverse environments
vcl01130  Biosynthesis of antibiotics
vcl01200  Carbon metabolism
Module
vcl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCLMA_A2378
   00030 Pentose phosphate pathway
    VCLMA_A2378
   00051 Fructose and mannose metabolism
    VCLMA_A2378
  09102 Energy metabolism
   00680 Methane metabolism
    VCLMA_A2378
Enzymes [BR:vcl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     VCLMA_A2378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AEA79567
Position
I:2686342..2687349
Genome map
AA seq 335 aa AA seqDB search
MKRDLAMAFSRVTEGAALAGYKWLGRGDKNAADGAAVEVMRILLNQTEISGEIVIGEGEI
DEAPMLYIGEQVGLGGDAVDIAVDPIEGTRMTAMGQSNALAVLAAGEKGSFLKAPDMYME
KLVVGPGAKGCIDLNLPLKDNLNHVAKALGKPLTDLVVITLAKPRHDQVIAQMQQMGVRV
FAVPDGDVAASILTCMPDSEVDMMYCIGGAPEGVVSAAVIRALDGDMQGRLLPRHQVKGD
SEDNRIWGAKELERCQEMGVEAGKVLKMEDMARSDNVIFAATGITKGDLLDGISRKGNIA
TTETLLIRGRCRTIRRIRSIHYLERKDQQVRDIIL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgatttagcaatggctttttcccgcgtcaccgaaggtgccgcactcgcaggc
tataaatggttaggacgtggcgataaaaatgccgccgatggtgctgcggtagaagtgatg
cgcatcctgctcaaccaaacggagatcagcggtgaaattgtgattggtgaaggcgaaatt
gatgaagcgcctatgttgtacattggcgagcaagtcggcctggggggcgatgcggttgat
attgcggtcgaccctatcgaaggtactcgcatgaccgccatgggacaatctaacgcgtta
gccgtgcttgcggcgggcgaaaaaggcagtttcctgaaagcgcccgacatgtacatggaa
aagttggtggttggccccggagcaaaaggctgcatcgacctcaatttgccgctaaaagat
aacctaaaccatgtcgcaaaagcactcggcaaacccttaaccgatttggtggtgatcacg
cttgccaaaccgcgccacgaccaagtgattgcgcaaatgcaacagatgggcgtacgcgtt
tttgcggtgccggatggcgatgtcgccgcatcgattctgacctgtatgcccgatagtgaa
gtggacatgatgtactgcattggtggggcaccagaaggcgtagtctctgcggcggtgatc
cgcgcgctggatggcgacatgcaaggccgtttactgccgcgtcatcaagtcaaaggcgat
agcgaagataatcgaatttggggtgcaaaagagctcgaacgctgtcaagaaatgggcgta
gaagccggtaaagtgctgaaaatggaagacatggcacgcagcgataacgtgattttcgcg
gccactggcatcaccaaaggtgatttgcttgatggcatcagtcgcaaaggcaatatcgca
acaacagaaacactgctgatccgcggccgctgtcgcaccattcgtcgtattcgctcgatt
cactatctggagcgtaaagaccaacaagtgcgcgacatcattctctaa

DBGET integrated database retrieval system