KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_A2383Help
Entry
VCLMA_A2383       CDS       T01871                                 

Definition
(GenBank) Copper sensory histidine kinase CpxA
  KO
K07640  two-component system, OmpR family, sensor histidine kinase CpxA [EC:2.7.13.3]
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Pathway
vcl01503  Cationic antimicrobial peptide (CAMP) resistance
vcl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VCLMA_A2383
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    VCLMA_A2383
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vcl01001]
    VCLMA_A2383
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vcl02022]
    VCLMA_A2383
Enzymes [BR:vcl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VCLMA_A2383
Protein kinases [BR:vcl01001]
 Histidine kinases
  OmpR family
   VCLMA_A2383
Two-component system [BR:vcl02022]
 OmpR family
  CpxA-CpxR (envelope stress response)
   VCLMA_A2383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CpxA_peri HATPase_c HisKA HAMP HATPase_c_3 HATPase_c_2 HATPase_c_5 Clusterin P22_Tail-4 SOR_SNZ
Motif
Other DBs
NCBI-ProteinID: AEA79572
Position
I:2691142..2692536
Genome map
AA seq 464 aa AA seqDB search
MRLPLPKLNNLYGRIFAIFWFTMLLVLFAVLTLPHLDPRKSRDLSPETHQRLLESRDRFE
QQFRNQTDLRAILFQLEGPDSQHRKHDGQPRFFITDLESNIITNSKQTDFRFKAMQNFCS
SIESVQKPQQRLYGRYMLAGPVPITLAKQDLLLYVGMRWDEPPPFLLRLFDKPFQLLLAI
MLVSTPLLLWLAWALSKPAQNLAQAAQRVARGEFVHDPKLERGTAEFQQAGRSFNQMVDA
VNQMVSGQQRLLSDISHELRSPLTRLRMANALAMRKLGSSSELERIDTEAQRLEQMIGDL
LALSRMQINSHLMREVQPLSSLWEELLKDAQFEAEQMHKTLTFDAIPERTINGTPKLLMS
ALENVVRNAIHYGQQQIHVAFTIQDQQLIVSVDDDGEGVPEEELADIFRPFYRVSTARDR
HSGGTGLGLAITENAIRQHSGTISANRSHLGGLQVRFTLPLASA
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctaccgttaccgaaattgaataacctgtatgggcgcatctttgcgattttctgg
tttaccatgctgttggtactgttcgcggtattgaccctacctcatcttgacccgcgtaaa
tcacgtgacttatcacccgaaacgcatcaacgtttgctcgagagcagagatcgctttgaa
cagcaatttcgcaaccaaaccgacttaagagccattctgtttcagctcgaagggccagac
agtcagcaccgtaaacacgatggtcagccgcgtttttttatcaccgatttagaaagcaac
attatcaccaactcaaagcagaccgattttcgttttaaagcgatgcaaaacttctgctcc
agtattgaatcggttcaaaaaccacagcagcgcctgtatggccgttatatgttggcaggc
ccagtgcccattacgttagccaagcaagatctgctgttgtatgtcggtatgcgctgggat
gagccgccgccgtttttgctgcgtctgtttgataaacccttccaactcttgttggcaatc
atgctggtgagcaccccgctgctactgtggctggcgtgggctttgagtaaaccggcgcaa
aatctggctcaagccgcgcagcgtgtcgcgcggggcgaatttgtgcatgacccaaaatta
gagcgcggtacggcggagtttcaacaggcgggacgcagctttaaccagatggtggatgca
gtcaatcagatggtttctgggcagcaaagactgctttctgacatttctcacgaattgcgt
tcacccttaactcggctacgcatggccaacgcgctggcaatgcgtaaactcggcagtagc
agtgaattagaacggatcgataccgaagcacaacgtttagagcagatgattggggattta
ctggcgctctcacgcatgcaaatcaatagccatttaatgcgcgaagtgcagccactgagt
agtttatgggaagagttgctcaaagatgcgcaatttgaagctgaacagatgcacaaaacg
ctgacttttgacgcgatcccagagcgaaccatcaacggcacgcctaaattactgatgagt
gcattggaaaacgtggtgcgtaacgcgatccactacgggcaacagcagatccacgtagcc
tttaccattcaagaccagcaactcatcgtgagcgtcgatgatgatggcgaaggtgtaccc
gaagaggagttggcggatattttccgcccgttctatcgcgtctcgacagcgcgggatcga
cacagcggtggcacagggcttggtttagccatcaccgaaaatgccattcgccaacacagt
ggcactatcagcgcaaaccgcagtcacttaggaggcttacaagttcgctttactttacct
ctggcgagcgcttaa

DBGET integrated database retrieval system