KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_A2404Help
Entry
VCLMA_A2404       CDS       T01871                                 

Definition
(GenBank) Two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Pathway
vcl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VCLMA_A2404
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vcl02022]
    VCLMA_A2404
Two-component system [BR:vcl02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   VCLMA_A2404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AEA79591
Position
I:complement(2719105..2719827)
Genome map
AA seq 240 aa AA seqDB search
MVENHKVLVVDDDARLRALLERYLSEQGFQVRSVANGEQMDRLLTRENFHLMVLDLMLPG
EDGLSICRRLRNSNNMIPILMLTAKGDEIDRIVGLEVGADDYLPKPFNPRELLARIKAVL
RRQVIEAPGAPSAEETIIEFGEFRLNLGTREMFRGEEAMPLTSGEFAVLKALVTNAREPL
SRDKLMNMARGREYSAMERSIDVQISRLRRMLEVDPSKPRYIQTVWGLGYVFVPDGKAAN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaaatcataaagttttagtggtagatgatgatgcgcgtttgcgcgcgctgctt
gagcgttacctgtccgagcaggggtttcaagttcgcagcgtggcgaacggtgagcagatg
gatcgtctgctgacgcgcgaaaacttccatttgatggtgctggatttgatgttgccgggt
gaagatggtctttctatctgtcgtcgtctgcgcaattccaacaacatgatcccgattctg
atgctcactgccaaaggcgatgagattgaccgcattgtcggcctagaagttggtgccgat
gattacctgcctaagccatttaacccacgtgagttgctggcgcgtatcaaagcggtattg
cgccgccaagtgattgaagcgccgggagcgcccagtgcagaagagaccatcattgaattt
ggtgagtttcgcttaaatcttggtacgcgagaaatgttccgtggtgaagaggcaatgccg
ctcacttccggtgaatttgctgtgttaaaagcactcgtgaccaatgcccgtgaaccgctt
tcgcgcgataaactgatgaacatggcgcgtggccgcgaatattccgcgatggagcgttcg
attgacgtacagatttctcgtctacgtcgtatgctcgaagttgaccctagcaaaccgcgc
tatattcaaaccgtatggggactcggttacgtgtttgttcctgatggtaaagccgccaac
taa

DBGET integrated database retrieval system