KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_B0095
Entry
VCLMA_B0095       CDS       T01871                                 

Definition
(GenBank) Uncharacterized protein ImpB
  KO
K11901  type VI secretion system protein ImpB
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcl02044]
    VCLMA_B0095
Secretion system [BR:vcl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCLMA_B0095
SSDB
Motif
Pfam: T6SS_VipA BACON
Other DBs
NCBI-ProteinID: AEA79741
Structure
PDB: 
5MXN 5MYU

Position
II:114221..114727
AA seq 168 aa
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKN
NFEAVMRESELKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELR
EALVALKGPLGNIPAFRERLQSLLNSEESREKLLAELNLLSGQEEPQA
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtctaaagaaggaagtgtagctcccaaagagcggattaatatcaagtatattccggcg
acgggggatgcacaggctgaggttgagctaccactcaaaaccctggttgtaggtgatttc
aaagggcatgcggagcaaaccccattggaagagcgtgcaacagtcacggtagataagaac
aactttgaagccgtaatgcgcgagagcgagctgaaaatcaccgccacggtgaaaaacaag
ctgactgatgatgagaatgccgagcttcctgttgaactcaatttcaaatccttagccgac
ttcgctcctgatgcggtggcatcacaagttccagaactgaaaaaattgattgagttgcgt
gaagcgttagttgcccttaaagggccgctaggcaacattcccgcatttcgtgagcgttta
cagtcattactcaactcagaagagtcgagagaaaaactgttggcagaactgaatctgctc
agtggtcaagaagagccacaagcgtaa

DBGET integrated database retrieval system