KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_B0101
Entry
VCLMA_B0101       CDS       T01871                                 

Definition
(GenBank) Type VI secretion lipoprotein/VasD
  KO
K11906  type VI secretion system protein VasD
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Pathway
vcl03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VCLMA_B0101
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcl02044]
    VCLMA_B0101
Secretion system [BR:vcl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCLMA_B0101
SSDB
Motif
Pfam: T6SS-SciN LPAM_1
Other DBs
NCBI-ProteinID: AEA79747
Position
II:120934..121410
AA seq 158 aa
MNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFEL
KDDSMFMSSDYDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHF
AEPELSEWKKAVKVINKGREYHLLMLFKDYDVKLDRVE
NT seq 477 nt   +upstreamnt  +downstreamnt
gtgaacaaagtgctgtggatgctgtttgccttgacggtgctgaccgcgtgcagttcgtcg
gataagtacgagcctgcgaaagagccgaccaaggtgacttttagcttagtcagcgatgaa
ggggtgaacccgaacatctggggtgaagcgtcaccgatagaaattcaagtttttgagcta
aaggatgactcgatgtttatgtcgtccgactacgaccagatcaaaaccgattataaaaaa
gcgctgcgcagtaactttgttaaaaactacgactatgtactgactccagggcagttcaaa
ttcgtcaacgctttcgaagtcgatgaggagaccaactacatcggcgtgatggctcatttt
gccgagccggaacttagcgaatggaagaaagcggtcaaggtgatcaataaagggcgagag
tatcacttgctgatgctgtttaaagactacgatgtgaaattggatagggtggaataa

DBGET integrated database retrieval system