KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_B0102
Entry
VCLMA_B0102       CDS       T01871                                 

Definition
(GenBank) Uncharacterized protein ImpJ/VasE
  KO
K11893  type VI secretion system protein ImpJ
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcl02044]
    VCLMA_B0102
Secretion system [BR:vcl02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCLMA_B0102
SSDB
Motif
Pfam: T6SS_VasE GMP_synt_C
Other DBs
NCBI-ProteinID: AEA79748
Position
II:121417..122751
AA seq 444 aa
MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRI
AIERAVGVMPDGTTFRIPQEDHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERG
TGRYVSRRLEVRDVHSVQGDTTTIDVSPVRLQLMLEREDRSAYASIAIGRILEKRPDGSV
VLDPDFIPCHLNVVGISALHRFINEMSGLMRERAKNIAQRISSPAQGGVADVSDFMLLQA
LNRLQPQMKHLAELRSLHPERLFECLSCVCGELATFTDESRLPPSLPSYNHDSPSHSFQP
LIRSLRQSLSVVLEPRAVSIQLDKRKYGLMVAPIHDPQLMESAEFIIAVKARMPLDELRR
LFTQQTKVASVEKIRELISLQLPGIPLTPLPVAPRQLPYHAGYTYYQLDKTSAAWAMLTH
SSGFAFHVAAAFDDLELQFWAIRS
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtttgcgcgtaaccgagtgatctggaatgaagggctatttattaagccgcaacatttc
cagcaacagcagagatatacggagtactgcctagacgagcgcctgagcaccgtgagccgt
tacttgtatgggatttccgagttgtcgctcaacccagaatacctctcgtttggccgtatt
gcgattgagcgtgcggtcggcgtgatgcccgatggcaccacctttcgtattcctcaagaa
gatcatcttcccgatgcgctcgaagtgaccgatgcgtcactggcaaaccagattgtctac
ttagccgtaccgctacgtagtgagtcgctgatggagattaactggccagaagagcgtggt
acggggcgctatgtcagccgtcgtctcgaagtgcgtgatgtccacagcgtgcagggtgat
accacgacgattgatgtttcccctgtgcgtttgcaactcatgcttgagcgagaggatcgc
agtgcgtatgcctcaattgctattggccgtattttagaaaaacgtcctgatggcagtgtg
gtgctcgatccggatttcatcccttgtcacttgaatgtggttggcatctctgcgctgcac
cgctttattaatgagatgtcaggcctgatgcgtgagcgagcgaaaaatattgctcagcgg
atcagctctccagcacaaggtggggttgctgatgtttcggactttatgctgctgcaagct
ttaaaccgtctgcaaccacaaatgaagcatttggcagagctgcgcagcttacacccagag
cgtctgtttgaatgtctctcgtgtgtgtgtggtgagctggctacctttactgacgaaagt
cgtctgccgcccagtttgccaagctataaccatgattcacccagccactctttccagccg
ctgatccgcagcttgcgtcagagcttgagcgtggtgctagagccgcgcgccgtctctatc
caactggataaacgtaagtacggtttgatggttgcgccaatccatgatccgcaactgatg
gagagtgcagagtttatcatcgcggttaaagctcgcatgccgttggatgagctacgccgt
ctgtttactcagcaaaccaaagtggcatcggttgagaaaattcgtgaactcatctcactg
caactgccgggtattccattgacgccattaccggtcgcaccgcgccaattgccttaccac
gctggctacacctactaccaactggataaaaccagcgctgcatgggcgatgttgactcat
tccagcggttttgcgttccacgttgctgcagcttttgacgatcttgagctgcaattctgg
gctatcaggagctaa

DBGET integrated database retrieval system