KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_B0477Help
Entry
VCLMA_B0477       CDS       T01871                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Pathway
vcl00071  Fatty acid degradation
vcl00280  Valine, leucine and isoleucine degradation
vcl00310  Lysine degradation
vcl00362  Benzoate degradation
vcl00380  Tryptophan metabolism
vcl00620  Pyruvate metabolism
vcl00630  Glyoxylate and dicarboxylate metabolism
vcl00640  Propanoate metabolism
vcl00650  Butanoate metabolism
vcl00900  Terpenoid backbone biosynthesis
vcl01100  Metabolic pathways
vcl01110  Biosynthesis of secondary metabolites
vcl01120  Microbial metabolism in diverse environments
vcl01130  Biosynthesis of antibiotics
vcl01200  Carbon metabolism
vcl01212  Fatty acid metabolism
vcl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VCLMA_B0477
   00630 Glyoxylate and dicarboxylate metabolism
    VCLMA_B0477
   00640 Propanoate metabolism
    VCLMA_B0477
   00650 Butanoate metabolism
    VCLMA_B0477
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VCLMA_B0477
   00072 Synthesis and degradation of ketone bodies
    VCLMA_B0477
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VCLMA_B0477
   00310 Lysine degradation
    VCLMA_B0477
   00380 Tryptophan metabolism
    VCLMA_B0477
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VCLMA_B0477
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VCLMA_B0477
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VCLMA_B0477
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vcl04147]
    VCLMA_B0477
Enzymes [BR:vcl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VCLMA_B0477
Exosome [BR:vcl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCLMA_B0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEA80107
Position
II:complement(520146..521351)
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQVKPEAVDEVIVGNVVSAG
QGMGVGRQAALAAGVPQSVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPIPVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLAEQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatctatatcgtgggcgcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcggcaggcgctttggcaggacaagtcatccaagccgctcttgaagcc
gcacaagtcaaacctgaagctgtggatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagcggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatgcggttgcg
cacatcaaagcgggagatgcttctgtcgttgtggccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatagctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctattccggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggccgcattgcaaggcttacgcgccgcgttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agtgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtctagctgagcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccactaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgtcgcttcactctgcgtcggcggtggcatgggcaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system