KEGG   Vibrio cholerae O1 LMA3984-4: VCLMA_B0547Help
Entry
VCLMA_B0547       CDS       T01871                                 

Definition
(GenBank) Low-specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vcl  Vibrio cholerae O1 LMA3984-4
Pathway
vcl00260  Glycine, serine and threonine metabolism
vcl01100  Metabolic pathways
vcl01110  Biosynthesis of secondary metabolites
vcl01120  Microbial metabolism in diverse environments
vcl01130  Biosynthesis of antibiotics
vcl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VCLMA_B0547
Enzymes [BR:vcl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     VCLMA_B0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AEA80177
Position
II:597860..598867
Genome map
AA seq 335 aa AA seqDB search
MDFRSDTVTQPTDAMRQAMAQAPVGDDVYGDDPTVNELEQWAAERHGFEAALFTTSGTQA
NLLGLLAHCERGDEYLCGQQAHNYRYEAGGAAVLGSIQPQPIDNEPDGTLDFAKLKAAIK
PDDAHFARTKLLSLENTINGKVLPLSYLAKAREFVDQHGLQLHLDGARVYNAAVALDVDV
KEIAQYFDSITVCLSKGLAAPVGSLLLGSKDFIAKARRWRKMVGGGMRQAGILAAAGKLA
LTEQVTQLKTDHDNARHLALGLNALPGFSVNTEWVQTNIVFAKLDATVDIQSIAQQLRQA
GIIITAGNPVRFVTHKDITRQDIDTLLAKLRTLLA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggactttcgatcggataccgttacccaaccgaccgacgcgatgcgtcaagcgatggca
caagcccctgtgggtgacgatgtgtatggcgatgatcccaccgtcaacgagttagaacag
tgggcggccgagcgccatggctttgaagccgcgctgtttaccacctcaggcactcaagcc
aatttgttaggtttactcgctcattgcgagcgcggcgacgaatatttgtgtggccagcaa
gcccataactatcgttatgaagctggcggtgctgccgtacttggctctatccagccacaa
ccgattgacaatgaaccggatggcactctcgatttcgccaaactcaaagcagcgatcaaa
ccggatgatgcgcattttgcccgcaccaaactgctcagcttggaaaacaccatcaatggt
aaagtgcttccacttagttatttggcgaaggcgcgcgagtttgttgatcaacatggtttg
caactgcaccttgatggggctcgggtctacaacgcggcggtcgcactggatgtggatgtc
aaagagatcgcgcaatattttgattcgatcaccgtgtgtctatccaaaggcttagccgcg
ccagtcggttcgttactgctcggttccaaggactttattgccaaagcgagacgctggcga
aaaatggtcggtggcggtatgcgccaagcgggcattttagccgcagcggggaaattggcg
ctcaccgagcaagtcacgcagctcaagaccgatcatgataatgctcgtcatctggctttg
gggctgaatgctttaccggggttttcggttaataccgaatgggtacagaccaatattgtg
tttgctaaattggacgcgacagtcgatatccagtccatcgctcagcaacttcgccaagca
ggcattatcatcaccgcgggtaatccagtgcgcttcgtgacacataaagacattacacgt
caggatattgataccctactcgccaaactgcgcaccttactggcttga

DBGET integrated database retrieval system