KEGG   Vibrio cholerae O1 M66-2: VCM66_2597
Entry
VCM66_2597        CDS       T00891                                 
Name
(GenBank) transcriptional repressor, LacI family
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
vcm  Vibrio cholerae O1 M66-2
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vcm03000]
    VCM66_2597
Transcription factors [BR:vcm03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    VCM66_2597
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_38 HTH_Tnp_ISL3 HTH_Crp_2 ClpB_D2-small
Other DBs
NCBI-ProteinID: ACP06893
UniProt: C3LSA6
Position
I:complement(2781163..2782170)
AA seq 335 aa
MATMKDVAQLAGVSTATVSRALMNPEKVSSSTRKRVEEAVLEAGYSPNSLARNLRRNESK
TIVAIVPDICDPYFSEIIRGIEDAAMEHGYLVLLGDSGQQKRRENSFVNLVFTKQADGML
LLGTDLPFDVSKPEQKNLPPMVMACEFAPELELPTVHIDNLTSAFEAVNYLTQLGHKRIA
QISGPQHAALCQFRHQGYQQALRRAGITMNPTYCTFGDFTFEAGAKAVRQLLALPEQPTA
IFCHNDTMAIGAIQEAKRLGLRVPQDLSVVGFDDIQFAQYCDPPLTTISQPRYEIGRQAM
LMMLELLRGHDVRAGSRLLETKLVVRESAAPPSKK
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcgacaatgaaggatgttgcccagcttgctggagtttcaaccgcgaccgtgtctcgt
gcgttgatgaatccagagaaagtctcgtcgtccactcgtaaacgagtggaagaggccgtg
ctggaagcgggttactcacccaattctttggcgcgcaatttgcgccgtaatgaatcgaaa
accatcgttgctatcgtgccagatatctgtgatccctacttttctgagatcattcgcggt
attgaagatgccgcgatggagcacggttatctggtgctgttgggggatagtggtcaacag
aagcgtcgggagaactcgttcgttaatctggtgtttaccaaacaggcagacggtatgttg
ctgctggggacagatttgccgtttgatgtgagtaaacctgagcagaaaaacctaccgcct
atggtgatggcgtgtgaatttgcgccagagctggaattgccaacggtacacattgataac
ctgacctcggcatttgaggcggtaaactatctcactcagcttgggcacaaacggattgcg
cagatctcaggtccacaacatgctgcgctgtgccaattccgtcatcaaggctatcaacag
gcgttgcgtcgtgctggcatcaccatgaacccgacttactgcacttttggcgatttcact
tttgaagccggggcaaaagcggtgcgtcagctgttggcattgcctgagcagccgaccgcg
attttctgtcataacgatacgatggcgattggcgcaattcaggaagcgaagcgacttggc
ttgcgcgtaccgcaagatctctctgtggtcggttttgacgatattcagtttgcccagtac
tgcgatcccccattaaccaccatttcgcagccgcgttatgagattggccgtcaagccatg
ctgatgatgcttgagctgcttcgcggacacgatgtacgtgctggatcgcgtcttttggag
accaagctggtcgtgcgtgagagtgctgcgccgccaagcaagaagtaa

DBGET integrated database retrieval system