KEGG   Vibrio cholerae O1 M66-2: VCM66_0105Help
Entry
VCM66_0105        CDS       T00891                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm00860  Porphyrin and chlorophyll metabolism
vcm01100  Metabolic pathways
vcm01110  Biosynthesis of secondary metabolites
vcm01120  Microbial metabolism in diverse environments
Module
vcm_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
vcm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VCM66_0105 (hemB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vcm04147]
    VCM66_0105 (hemB)
Enzymes [BR:vcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     VCM66_0105 (hemB)
Exosome [BR:vcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VCM66_0105 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD CBP_BcsN
Motif
Other DBs
NCBI-ProteinID: ACP04441
UniProt: C3LPU7
Position
I:100776..101819
Genome map
AA seq 347 aa AA seqDB search
MSVSIQGQFPGRRLRRLRKHDFSRRLVAENQLSVNDLIYPMFILMGKDRREKVDSMPGVE
RLSIDLMLEEAQYLANLGVPAIALFPVVNQDAKSLCAAEAYNPEGLVQRAVRALKEHVPQ
MGVITDVALDPFTTHGQDGIIDEQGYVLNDETTEVLVKQALSHAQAGADVVAPSDMMDGR
IGRIRQALEEAGYIHTQIMAYSAKYASNYYGPFRDAVGSSANLKGGNKKNYQMDPANSDE
ALHEVAMDINEGADMVMVKPGMPYLDVVRRVKTELQVPTFAYQVSGEYAMHKAAIMNGWL
KERETVFESLLCFKRAGADGILTYFAKEVAEWLAEDSAKAAQFLPKK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggtatccattcaaggtcaatttcctgggcgtcgtttacgccgcctgcgtaaacat
gatttcagccgtcgccttgtggccgaaaaccagttgtcggtgaacgatctgatctacccg
atgtttattttgatgggtaaagatcgccgtgaaaaagtcgattccatgccgggcgtagaa
cgtttatccatcgatttaatgctggaagaagcacagtatctcgctaacctcggtgtgcct
gcgattgctctgtttcctgtggtcaatcaggatgcaaaaagcctatgtgctgccgaagct
tacaaccctgaaggcttagttcaacgcgcagtgcgtgcgctgaaagagcatgtgccgcaa
atgggcgtgatcactgatgtggcattggatccattcacaactcatggacaagacggcatc
atcgatgagcaaggttatgtgttgaatgatgaaacaacggaagtgctagtgaagcaagca
ctgtcgcatgctcaagctggtgcggatgtggttgccccttccgatatgatggatggccgt
attgggcgcattcgtcaagcattggaagaggcggggtacattcatactcaaatcatggct
tattccgctaaatatgcctcgaattactatgggccattccgtgatgcggtcgggtcatct
gcgaatttaaaaggtggcaacaagaaaaactaccaaatggaccccgccaattccgatgaa
gctttgcatgaagtcgcgatggacatcaatgaaggtgcggacatggtgatggtgaagccc
ggcatgccctatctagatgtggtgcgccgtgtcaaaaccgagttgcaggtaccgaccttc
gcttaccaagtttccggtgagtatgcgatgcacaaagcggcaatcatgaatggttggttg
aaagagcgggaaacggtattcgaatctttactctgcttcaaacgtgcaggtgcagatggc
attttgacttactttgcgaaagaggtggctgagtggttggcggaagacagcgcaaaagcc
gcgcagttcttacctaaaaagtaa

DBGET integrated database retrieval system