KEGG   Vibrio cholerae M66-2: VCM66_0119Help
Entry
VCM66_0119        CDS       T00891                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vcm  Vibrio cholerae M66-2
Pathway
vcm00860  Porphyrin and chlorophyll metabolism
vcm01100  Metabolic pathways
vcm01110  Biosynthesis of secondary metabolites
vcm01120  Microbial metabolism in diverse environments
Module
vcm_M00121  Heme biosynthesis, glutamate => heme
vcm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VCM66_0119 (hemD)
Enzymes [BR:vcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VCM66_0119 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 GATA-N
Motif
Other DBs
NCBI-ProteinID: ACP04455
UniProt: C3LPW1
Position
I:complement(113898..114680)
Genome map
AA seq 260 aa AA seqDB search
MIESVMTVLVTRPDEQGAELCQLLHQQGIPALHHPLLAISASPQLAALAEDLSSFDIIIA
VSQHAVIFSDQFLQHRRICWPNNAIYLAVGQKTAHVFSKACQQSVDYPEISDSEHLLALS
MLRDVAGKKVLILRGNGGRELIYSTLVERGATVRYQEAYCRHERPFAAAECVQKWQLAKV
DSLVITSSEQLAFFIRQFETSHLPWVQQLTLLVPSQRIATLAHQLGFHRIVVTLSAANRD
LVAALMPEKPTGTLSNDQQQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttgattgagagtgttatgacagtactggtcactcgtcctgatgaacaaggcgcagagctg
tgccagctgctgcaccagcagggcatccccgccctgcaccatccgctactcgccatctct
gccagccctcaacttgctgcgctggcagaagatttatcttcattcgatatcatcattgcc
gtcagtcaacatgccgtcatcttcagtgaccaatttctgcaacatcgccgaatttgttgg
ccaaataacgctatttaccttgccgttggtcaaaaaaccgcgcatgttttcagcaaagcc
tgccaacaatcagtagactatccagaaataagcgatagtgaacatctgctggcactcagt
atgctgcgtgatgtcgcaggtaagaaggtattgatcttacgtggtaatggtggtcgtgag
ctgatttattccaccttagtggaaagaggagcgactgtgcgctatcaagaagcgtattgt
cggcacgagcggccatttgccgccgccgagtgtgtccaaaaatggcagttggcgaaggtc
gactcactggtgatcaccagcagtgagcagttggctttttttatccgtcagttcgagaca
tcacacttgccatgggtgcagcagttaactttgctcgtacccagccaacggattgccact
ctcgcccaccaactaggatttcatcgcatcgtggtcacgctaagtgctgctaatcgcgat
ttagtcgcggcattgatgcccgaaaaaccaacaggaactctgagcaatgaccaacaacaa
taa

DBGET integrated database retrieval system