KEGG   Vibrio cholerae O1 M66-2: VCM66_0228Help
Entry
VCM66_0228        CDS       T00891                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-glycero-D-mannoheptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm00540  Lipopolysaccharide biosynthesis
vcm01100  Metabolic pathways
Module
vcm_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    VCM66_0228 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:vcm01005]
    VCM66_0228 (rfaD)
Enzymes [BR:vcm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     VCM66_0228 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:vcm01005]
 Unusual sugar
  VCM66_0228 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 KR NAD_binding_10 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACP04559
UniProt: C3LQK1
Position
I:complement(231131..232075)
Genome map
AA seq 314 aa AA seqDB search
MIIVTGGAGMIGSNIIKALNERGITDILVVDHLKNGRKFKNLVDLQIADYMDRDDFLAQI
MAGDDFGFIDAIFHEGACSATTEWDGKYVMLNNYEYSKELLHYCLDREIPFLYASSAATY
GETDTFIEEPQYEGALNVYGYSKQQFDNYVRRLWLDAKQHDETLSQITGFRYFNVYGPRE
QHKGSMASVAFHLNNQMNAGENPKLFAGSENFKRDFVYVGDVAAVNLWFLDHGVSGIFNC
GTGKAESFNEVAKAVIAFHGRGEVETIPFPDHLKGAYQEFTEADLTKLRAAGCDVQFKSV
AEGVAEYMALINRK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtaactggcggcgctggcatgattggcagcaacattatcaaagcgcttaat
gagcgcggtatcacagacattctggtcgtcgatcatttgaaaaatggtcgtaagttcaaa
aatctggttgacctacagatcgctgactacatggatcgagatgacttcctagctcagatc
atggccggtgatgattttgggttcattgacgccatttttcatgagggagcttgctctgcg
accacagagtgggatggcaaatatgtcatgctcaacaactatgaatactctaaagagctg
ctgcactactgtttagatcgtgaaatacccttcctgtatgcctcttcagcagccacttat
ggtgaaaccgatacctttattgaagaaccgcaatacgaaggtgcactcaacgtttacggc
tattcgaagcagcaatttgataactatgtacgccgcctatggctagatgcaaaacaacac
gacgaaaccctatcgcaaataacgggatttcgttacttcaacgtatacggccctcgtgag
cagcataaaggctcgatggcttcggttgcctttcatttgaacaatcaaatgaacgcgggt
gaaaatccaaaattgtttgctggcagcgagaacttcaaacgtgatttcgtttatgtcggc
gatgtcgctgcggtcaatttgtggtttttagatcatggcgtatccggcatatttaactgt
ggtactggtaaagcggaatcgttcaacgaagtggcgaaagcggtgatcgcattccatggt
cgcggcgaagtcgaaaccattccattcccagaccatcttaaaggtgcttaccaagagttc
actgaggctgaccttaccaaacttcgcgctgctggctgtgatgtacagttcaagagcgtg
gctgaaggtgtcgctgaatatatggcgctgattaatcgtaagtaa

DBGET integrated database retrieval system