KEGG   Vibrio cholerae O1 M66-2: VCM66_0229Help
Entry
VCM66_0229        CDS       T00891                                 

Gene name
rfbA
Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm00051  Fructose and mannose metabolism
vcm00520  Amino sugar and nucleotide sugar metabolism
vcm01100  Metabolic pathways
vcm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    VCM66_0229 (rfbA)
   00520 Amino sugar and nucleotide sugar metabolism
    VCM66_0229 (rfbA)
Enzymes [BR:vcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     VCM66_0229 (rfbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3 DUF261 Cupin_1
Motif
Other DBs
NCBI-ProteinID: ACP04560
UniProt: C3LQK2
Position
I:232517..233914
Genome map
AA seq 465 aa AA seqDB search
MFIPVIMAGGSGSRLWPLSRSAFPKQFLSLDSSSQHTMLQATIERLQGLPIAEPIVISNE
DHRFIVAEQIRRYGKKSRIILEPAGRNTAPAIALAAFTAIEQEDDPVLLVLAADHFVKNK
SAFQAAISQAAQQAEAGKLATFGIVPTTPETGYGYIHRGEEVTQGTYEINSFVEKPQLNI
AEQYLASGEYYWNSGCFMFKASVFLNELKQHSPEIYRQCELAMQGLSHDYDFIRVGVEEF
LKCPDDSIDYAVMEHTKLGVVVSMDAGWSDVGSWSALWEVSDKDADGNVCQGDAILSGTS
NCYIYAPNKLVAAVGLKDIVVVETKDAVLVADKNQVQEVKKIVEHLKAENRAEYREHRER
YRPWGKSDAIDKGERYKVNRITVEPGKKQSLQMHYHRAEHWVVVSGTAKVTCEGNVKVIT
ENQSLYIPIGTNHMIENPGKIPLELIEIQSGSYLNEDDVVRFEDK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtttatacctgtaattatggctggtggctccggctctaggctttggcccctttcacgt
tcggcttttccaaaacaattcttatccttagatagcagtagtcagcatactatgctacaa
gccactattgagcgtttacaggggctacctattgctgaacccattgttatttcgaatgaa
gatcatcgttttatcgttgcggaacaaattcgtcgttatggcaaaaagtctcgcattatc
ttagaaccagcaggaaggaacactgcacctgcgatcgccttagcagcatttacggcaatc
gaacaggaggatgaccccgtattgctagtattggctgccgatcattttgtaaaaaataaa
agtgcatttcaggctgctatttcacaagcagctcaacaggcagaggctggtaaacttgct
acttttggtatcgttcccaccactcctgaaacaggttatggttatattcaccggggtgaa
gaggttacacaaggcacttatgaaattaactcatttgttgaaaagccacagttaaatatt
gctgagcagtatttagccagtggtgaatattactggaacagtggttgttttatgtttaaa
gcttccgtgttcttaaatgagttgaagcaacattctccagagatctatcgccaatgtgaa
cttgcaatgcaaggcctttctcacgattacgattttattcgtgtcggtgtagaagagttc
cttaaatgtcctgatgattcaatcgactatgccgttatggagcacactaaactaggtgtg
gtagtatctatggatgccggatggagtgatgtaggttcttggtctgcattatgggaagta
tctgataaagatgcagacggtaacgtatgccaaggtgatgccattttaagtggcacctct
aattgttatatctacgccccaaataaactggttgctgcggttggcttgaaagatattgtt
gtggtggaaactaaagatgccgtgttagttgcagacaaaaaccaagtacaagaagtcaag
aagatagttgaacatttgaaggcagaaaaccgagctgaatatcgagaacacagggaacgt
tatcgcccttggggtaaatctgatgcgattgataaaggcgagcgttacaaagtaaaccgt
attacggttgagcctggtaaaaagcaatcattgcagatgcattaccaccgagcagagcac
tgggtagtggtctctggtactgccaaggtaacttgtgaaggtaatgttaaagtaatcacg
gaaaaccagtccttgtatatccctattggtacaaatcatatgatagaaaacccaggtaag
atcccgctagagcttattgaaattcaatccggttcatacctaaacgaagatgatgtagta
cgtttcgaggataaataa

DBGET integrated database retrieval system