KEGG   Vibrio cholerae O1 M66-2: VCM66_0427Help
Entry
VCM66_0427        CDS       T00891                                 

Gene name
apaG
Definition
(GenBank) apaG protein
  KO
K06195  ApaG protein
Organism
vcm  Vibrio cholerae O1 M66-2
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    VCM66_0427 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ACP04753
UniProt: C3LRH3
Structure
PDB: 

Position
I:complement(455991..456371)
Genome map
AA seq 126 aa AA seqDB search
MDVSLPCIKIQVQTRYIEEQSNPEYQRFVFAYLITIKNLSSQTVQLMSRRWLITDADGKQ
TVVEGDGVVGEQPRIKANDEYTYSSGTALDTPVGVMQGQYLMIDEQGESFTVEIEPFRLA
VPHVLN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggatgtttcgctgccctgtatcaaaattcaggttcaaactcgctacattgaggaacaa
tcaaatcctgagtatcagcgctttgtgttcgcctatctcatcaccatcaaaaatctcagc
tcccagaccgtccaactgatgagtcggcgctggttgatcacggatgccgatggcaaacag
accgtggttgaaggcgatggcgttgtgggagagcaacctcgcatcaaagctaacgatgaa
tatacctacagcagtggcacggccttagatactcccgtcggtgtgatgcaggggcaatat
ttgatgatcgatgaacaaggtgagtctttcacggttgagattgaaccatttcgtttagcc
gttccgcatgtattgaattaa

DBGET integrated database retrieval system