KEGG   Vibrio cholerae O1 M66-2: VCM66_0845Help
Entry
VCM66_0845        CDS       T00891                                 

Definition
(GenBank) pseudouridine synthase Rlu family protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
vcm  Vibrio cholerae O1 M66-2
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vcm03016]
    VCM66_0845
Enzymes [BR:vcm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     VCM66_0845
Transfer RNA biogenesis [BR:vcm03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    VCM66_0845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ACP05164
UniProt: C3LTD8
Position
I:904143..904877
Genome map
AA seq 244 aa AA seqDB search
MLEIVYQDEYLVAVNKPAGMLVHRSWLDKHETEFVMQTLRDQIGQHVFPLHRLDRPTSGV
LVFALSSQIASEVMPMFANHEMEKTYHAIVRGWIEEANVLDYPLKEELDKIADKFAKQDK
EAQSAVTAYRPLAKVELPIATGKFATTRYCLMEMQPKTGRKHQLRRHMAHLRHPIVGDTT
HGDGVHNRLFREHFSAQRLMLHASELRFMHPYTQQPLVIRAGLDEVWQGLLSEFGWQESL
LINA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagattgtttatcaagatgaatatttggtggcggtcaataaaccggctggcatg
ttggtgcaccgttcatggctcgacaagcatgaaaccgagtttgtgatgcagaccctgcgc
gatcaaattggtcagcacgttttcccgctacaccgtctggatcgcccgacatccggtgtg
ttggtgtttgcgctttcgagtcagattgcctctgaagtgatgccgatgtttgccaatcat
gagatggagaaaacctaccacgccattgtgcgcggctggattgaagaggcaaatgtgctc
gattatccactcaaagaagagctcgacaaaattgccgataaatttgccaagcaagataaa
gaagcgcagtcggcggtgacagcttatcggccactcgccaaagtggaactgcccattgct
acgggaaagtttgccactacccgctattgcttgatggagatgcaaccgaagaccgggcgc
aaacatcagctgcgtcgtcatatggcacatctgcgtcatccgatagtgggtgataccacc
catggcgatggagttcataaccgactgtttcgtgaacacttttccgcgcaacgtttgatg
ctgcatgccagcgagttacgttttatgcatccttatacccagcagccgttagtgattcgc
gctggactagatgaagtgtggcaaggcttgcttagtgagtttggttggcaagagtcgctg
ttaatcaacgcttga

DBGET integrated database retrieval system