KEGG   Vibrio cholerae O1 M66-2: VCM66_1132Help
Entry
VCM66_1132        CDS       T00891                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
vcm  Vibrio cholerae O1 M66-2
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VCM66_1132
Enzymes [BR:vcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     VCM66_1132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP IPPT DUF3053
Motif
Other DBs
NCBI-ProteinID: ACP05449
UniProt: C3LLM3
Position
I:1206673..1207545
Genome map
AA seq 290 aa AA seqDB search
MRIDLHSHTTASDGRFTYQQLIDRAVSFEIDVLAITDHDTVAALADARAYIAQQQYPLQL
VNGIEISTVWQNKDIHIVGLNIDPNSEALGQLIARQQQRRVERAELIAHRLQKATREGVL
EEVQHIADGAPITRAHFAKWLVDNGYATNMQQVFKKYLTRDNPGYVPPNWCSMSEAVSAI
HAAGGQAVLAHPGRYDLTAKWLKRLMTAFVEAGGDAMEVAQPQQSPQEKRTLGDYAMEYQ
LLASQGSDFHYPSPWMELGRNLWLPAGVEPVWKDWGLSPSNRVERLDEEE
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagaattgacctgcatagtcataccaccgcttctgatggacggtttacttatcaacaa
ttgatcgatcgcgccgtcagctttgagattgatgttttggcgatcacagaccacgatacc
gtggctgcattggcggatgcccgtgcttacattgcacagcagcaatatccgctacaatta
gtgaacggcattgagatttcaacggtttggcaaaataaagacattcatattgtcggttta
aacatcgacccaaacagtgaggcattggggcagctgattgcgcggcagcagcaacgtcga
gttgagcgtgctgaactgatcgcccatcgtttacaaaaagcgacgcgtgagggagtgtta
gaagaggttcaacatattgccgatggtgcgccgatcacgcgtgcccattttgccaaatgg
ttggtggataatggttacgcaaccaacatgcagcaagtatttaagaaatacctcactcgt
gataatccgggttatgtaccgcctaactggtgttcaatgagtgaagcagtgagcgcgatt
cacgccgcaggtggacaagccgtattagcgcatccgggacgatatgacttgacggcgaaa
tggcttaagcgcttaatgaccgcgtttgttgaagcgggtggcgatgctatggaagtggcc
cagccgcagcaatcaccacaggaaaaacgaaccttgggtgattacgcaatggaataccaa
ctactcgcctcccaaggcagtgactttcactatccttctccttggatggagttgggccga
aacctttggttacctgccggagtagaacctgtatggaaagattggggcttatccccaagc
aatagagtcgagagactcgatgaagaggaataa

DBGET integrated database retrieval system