KEGG   Vibrio cholerae O1 M66-2: VCM66_1195Help
Entry
VCM66_1195        CDS       T00891                                 

Definition
(GenBank) putative alpha-ribazole-5`-phosphate phosphatase CobC
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm00860  Porphyrin and chlorophyll metabolism
vcm01100  Metabolic pathways
Module
vcm_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VCM66_1195
Enzymes [BR:vcm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     VCM66_1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 CBP_BcsO
Motif
Other DBs
NCBI-ProteinID: ACP05512
UniProt: C3LLT6
Position
I:1271339..1271941
Genome map
AA seq 200 aa AA seqDB search
MIRIWLLRHGKTQGPAALNGITDVAVKPSVQQAIASQLSTLPFTRVISSPLRRCADLARL
LQSARPHVMLDFDPQLQELNFGELDGQSFADLETQWPILDAFWQDPAKNTLPQAEPLAMA
YQRVSQAWQQWLPKLESDTLILCHAGTIRLILAHVLGVDWRNPHWHTRLTIPHQSVTELV
LYPGEPPIVSVTSIGNALCR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatccgaatttggttactgcgtcacggcaaaacacaaggccctgcagccctgaatggt
ataacggatgtcgcggtgaagccgagcgtgcagcaagcgatagccagccaattgagcact
ttgccgtttactcgtgtgataagctcccccttacgtcgctgcgccgatctggcgcgattg
ctccaatcagctcgtccgcacgttatgctcgatttcgacccgcagctccaagagcttaac
tttggtgagttggatggacaaagttttgccgacttggagactcaatggccaatattggat
gccttttggcaagaccccgcaaagaacacactgccacaagctgaacctctcgctatggcc
tatcaaagagtgagtcaagcttggcaacaatggttacctaagcttgagagcgatacgctt
atcctctgccatgcaggaaccatacgtttgattttggcacacgtattgggtgtcgattgg
cgcaacccacactggcatactcggttaaccattcctcatcaatcggtgacagagcttgtc
ctttatcccggtgagccaccgatagtgagcgtgaccagcatcggaaatgcgctttgccgt
tag

DBGET integrated database retrieval system