KEGG   Vibrio cholerae O1 M66-2: VCM66_1371
Entry
VCM66_1371        CDS       T00891                                 

Gene name
vgrG-1
Definition
(GenBank) vgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VCM66_1371 (vgrG-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcm02044]
    VCM66_1371 (vgrG-1)
Secretion system [BR:vcm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCM66_1371 (vgrG-1)
SSDB
Motif
Pfam: ACD Phage_GPD Phage_base_V Phage_Mu_Gp45 DUF2345
Other DBs
NCBI-ProteinID: ACP05687
UniProt: C3LMB1
Structure
PDB: 

Position
I:1467720..1471211
AA seq 1163 aa
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYEVQLASRVSNLTAEQM
VDKRAELKLYRNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQK
QTVPEILSILLQEMGINDYAFALKRDGVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHE
AGKHTLYFSDASDSLSKLPEPIPYNALVGGAIDTPYIHGLTYRTQAEVSEVQLKDYSFKK
PAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFSQIRLDYLRRHAHTATGQSNE
PLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEDGGSGATTYSNQFSLIPGHL
HWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVEFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTE
THQGEGFNELSFEDQAGKEQIYLHAQKDFDGLIENDHTTVIRHDHHLTVENDQFTQIKHN
QHLTVEWESREAVTGEQVLSIEGSLHVKTGKVWVNEAGTEIHVKAGQKVVIEAGSEITVK
AGGSFVKVDPAGVHLSGALVNLNSGGSAGSGSGFGGAMPALPGGLEPAVALAPPQTISYQ
ALLQAEQANVPAVKVCPLAAQEATPAVNSITPPPPPPIAPPMAPPQPIMNPQPTANAQPN
LGRSTKATPDFPTHFPKSSIGIENELAGLVVAMPANSAQKFGYVKSAQGDALFMLTKDMN
QGSYQRPPSLQDGKNYQNWQTHTVELVSYPCEMDDKAAVETRKQAMLWLATHFTTHIDQS
NHQPLAPIQSEDGRFVIEITNAKHVIAAGNGISAESQGQTITMTPSGQQATVGVAAKGFG
TSATPELRLLESAPWYQKSLKSQFASLTSAENLDDKELAANVFAYLTSIYLKTAELAKKF
GIYINEWDPMSEQITPNANGLTDPKVKNAWEILPRTKPSKIVEILSKSDAKAVMKHIKPQ
LQSRYSESLSKNVFQYFQDGGEVAGHGINNATVGDKHSPELAILFEFRTVPNELQSYLPK
TESTTKSEVKLLDQFDPMKRKTVIQQVESLVQNSGDAFDKWYQSYRDSMNQPPVKNAKKI
ASANQKAQWVKEHNPQEWQRIIA
NT seq 3492 nt   +upstreamnt  +downstreamnt
atggcgacattagcgtacagcattgaggtggaagggctggaagatgagactctggtggtc
agaggcttccacgggcaggagtcactctctaatagtgtttttttagggcaagcctgttac
gggtttcgctacgaagtgcaactggcgagtcgggtatcaaacctcaccgccgagcagatg
gtggataagcgtgccgagctcaagctttaccgcaactcacagttggtgcagcgcgtgcac
ggcattgtgcgtgctttcagccaaggcgatatcggccatcaccacaccttctaccaactc
actttagtccctgccttagagcgcttatccctgcgtcataacagccgcattttccaaaag
cagactgtccctgagattctctctatcttgctgcaagagatgggcatcaacgattacgct
tttgcgctcaaacgtgatggcgtgcagcgtgagttttgtgtgcagtaccgcgaaagcgat
atcgactttctgcaccgcctcgccgctgaagaaggtttggtgtacagctttgtccatgaa
gcgggcaaacataccctctatttcagtgatgccagtgatagcctaagcaaactgccggag
cctatcccatacaacgctttagtcggtggcgcgatagataccccgtatatccacggctta
acctatcgcacccaagcagaagtgagcgaagttcagctcaaagactacagcttcaaaaag
ccagcctactcctttttgcaaaccgtgcagggtactgagctggattatcagcaaacgcgc
taccaacattttgatgcgccggggcgctacaaagacgatgtgaacggcgccgcctttagc
caaatccgtttagactacctgcgccgccatgcccataccgcaacagggcagagcaacgag
ccgctgctgcgtgccggctataagtttgacctgcaagagcaccttgaccccgcgatgaac
cgcgattgggtggtagtgtcgattaaccaccaaggtgagcagccgcaagcgctacaagaa
gacggtggcagcggcgctactacttacagcaatcagttcagcttaattccggggcatctt
cactggcgcgccgagccacaacccaaaccgcaagtcgatggtccaatgattgccacggtc
gtcggtcctgaaggcgaagaaatcttctgtgatgaacatgggcgggtgaaaatccatttc
ccgtgggaccgttactcgaacggtaacgagcaaagctcctgttgggtacgggtgtcgcaa
ggttgggcgggcagtcagtatggctttatcgctattccgcgcatcggccatgaagtgatt
gtagagtttttaaacggtgacccagaccaaccgattatcactggccgcacttatcatgcg
accaacacgccgccatacaccttgcctgagcacaaaaccaaaaccgtgctgcgcaccgag
acgcaccaaggggagggctttaacgagctcagttttgaagaccaagcgggcaaagagcaa
atctacctgcatgcgcagaaagattttgatggtttgattgaaaacgaccacaccacggtc
attcgtcacgaccatcacctgaccgttgaaaacgaccaatttacccagattaagcacaac
caacacctgacggtggagtgggaaagtcgagaagcggtaacgggcgagcaagtgctgagt
attgaaggctcgctgcatgtgaaaacaggcaaagtttgggtcaatgaagcgggtacagag
atccatgtaaaagcgggacagaaagtggtgattgaagcgggctccgagattaccgttaaa
gcgggcggcagctttgtgaaagtcgatccggctggggtgcatctgtccggtgctttggtc
aatctcaactctggcggcagcgctggtagtggtagcggctttggcggtgcaatgcccgcc
ttaccgggcggcttagaacccgccgtggcactggctccaccgcaaaccatctcttaccaa
gcgttgctacaggccgagcaagcgaatgttcctgcggtgaaggtgtgtcctttagccgct
caagaagcaacgcctgcggtgaatagtatcacgccgcctccaccaccaccgattgctccg
ccaatggccccaccacaaccaataatgaatccacagccaaccgctaacgcgcagcctaat
cttggaagatccactaaggcaacgccggattttccaacacatttcccgaagtcatccatt
ggcattgagaatgagttagctggtctagtggtggctatgccagccaactcggcacagaaa
tttggctacgtgaaaagtgcacaaggtgatgcgctgtttatgttaacgaaagacatgaac
caaggttcgtatcagcggccaccttcattacaagatggaaaaaattatcagaattggcag
acgcatacagtagagttggtgagctacccttgtgaaatggacgataaagctgccgttgaa
acacgcaaacaagccatgttgtggttagcaacccactttactacgcatatcgaccagtcc
aatcatcaaccattagctcctattcaaagtgaagacggacgctttgttatcgaaatcact
aatgcgaagcatgtgattgctgcgggcaatgggatttctgcagaatctcaaggtcaaaca
atcacgatgacaccaagtggacaacaagccacagtgggtgttgctgctaaaggtttcggg
acgagtgcaacgccagaattaaggttacttgaatcggcaccttggtatcagaaatcactc
aagagccaatttgcatctctaacgagcgcagaaaacttggatgataaagagttagctgca
aacgtatttgcttatctgacgtctatttatttaaaaacagcagagctagcgaagaagttt
ggtatttacatcaatgaatgggaccccatgtcggagcaaattactccaaatgcgaatgga
ttaacggatccaaaagtaaaaaatgcatgggaaatattgccacgtacaaaaccaagcaaa
atagtagaaatactcagtaagagtgatgccaaagcggttatgaaacatatcaagcctcaa
ttgcagtctcgctattctgagagtttgtcgaaaaatgtatttcaatatttccaagatggt
ggtgaagtagccggacacggtattaataatgcgacggtcggtgataaacatagtccggaa
ttggcgattttgtttgagttcagaactgttccgaatgaactgcaaagttatttgcctaaa
acagaatcgacaactaagtcagaagtgaagttactcgatcagtttgatcctatgaagcgt
aaaacagtaattcaacaagtagaatcgcttgtgcaaaatagtggcgatgcatttgataaa
tggtaccaaagctaccgagactccatgaatcaacctcccgttaaaaatgcgaagaaaatt
gcttccgcgaatcaaaaagcacaatgggttaaagagcataatcctcaagaatggcaacgc
attattgcttag

DBGET integrated database retrieval system