KEGG   Vibrio cholerae O1 M66-2: VCM66_1373
Entry
VCM66_1373        CDS       T00891                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vcm  Vibrio cholerae O1 M66-2
SSDB
Motif
Pfam: Lipase_3 CarboxypepD_reg SdrD_B
Other DBs
NCBI-ProteinID: ACP05689
UniProt: C3LMB3
Position
I:1472053..1473978
AA seq 641 aa
MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKI
AAGEWRASVSQASLLTEVEKYASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWD
EAPKDEFLQKQHKGIDVNASAEKAGFRLSHNQTYVFEIKALRSYMPVIIDTDEFNLVNSY
TFALLSKLAYATNDFNRDDGKTIDNQGAISTVISQLKRKERPTYSGDLQAKWLLEEIPYS
KALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSKKPPVDNTKFKIIKAASGMAA
VIADKIESATDSPGMKDLIITDLDAAQIAPEEFGGTYVHRGFYQYTMALLSLMEKDLGLH
KIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGMPRVGTRSFVERYQNILHYRH
VNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTY
NSNNQVLLTPKQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQYIPNLFEQLTALS
DESLMVHYQRAISALEQEIATLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLI
ENRNKIRGELRQIVSDPQRMPATKFLISQQTLPDEIKVQIR
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggattcatttaattattgcgtgcagtgtaaccctgaggaaaactggttagagctagag
tttcggagtgaaaatgatgaaccgatagatggtttgctagttacgattacgaaccaaagt
gccccctctaacacatacacgcaaaccacaagttcgggtaaggtgttgtttggcaagatt
gcggctggggaatggcgtgcttctgtaagccaagcttctctgttaactgaagtcgaaaaa
tatgccagccgtaaagagggacaagagtcgccagtgaaaaaacgagctgcggcagaactt
gacgccgcagataaagatacgaagcagtaccgctttaccactattggtgatttctgggat
gaagcaccaaaagatgagtttttacaaaagcagcataaagggatagatgtcaatgcttct
gctgagaaagcagggtttagactcagtcataaccagacctatgtttttgaaatcaaagca
ctacgtagctatatgccagtgattattgataccgatgaatttaacttggtgaatagttat
acctttgcgttgttgtcgaaattagcttatgcgactaacgattttaatagggatgatggt
aagacaatagataatcagggagcaattagcacggttatttctcaattgaagcgtaaagaa
agaccgacttattctggagatttacaagcaaagtggttattagaggaaattccatatagc
aaagcgttaagtgcccaatattatgctgaggatgatgtcggtagtgaaggttacatcatc
tttaacgatgaattggcgattataggtgtgagaggtacagagccttattttcagagtaag
aaaccacctgttgataacactaaatttaaaattataaaagcggcttcaggtatggcggct
gtgattgcggataagatagaaagtgctaccgattcaccaggaatgaaagaccttattata
acagaccttgatgctgcgcaaatcgcccccgaagagtttggtggaacatatgttcatcgg
gggttttaccaatatacgatggctttgttatctttgatggagaaagatctagggctacat
aaaataaaaaaattctattgttgtggccatagcttagggggcgctggtgcattacttata
agtgcattgattaaagatagctatcatcctccagtattgcgtttatatacatatggaatg
ccacgagtgggaactcgcagttttgtagagcgctatcaaaatattttgcattaccgtcat
gttaataatcacgatttggtgccacagataccaacagtatggatgaacacagatgtatct
gaaggattccatgtacttgatgtatttaaaagccgtgttgatctgatgagaaaaatgctc
actgatgatgatgatgacaattatcaacaccatggtcatttgtctcagttactaacttat
aattcaaataaccaagtcttactgacacccaaacaaactcaagtcactatgctagaccta
gcaaatttagccactaatgattctgttgctatggtagatggtttatcagatgcctcaata
gtagagcatggaatggagcagtatatacccaatttatttgagcagttaacagcactaagt
gatgaaagtttaatggtgcattatcaacgagcgatttcagccttagagcaggaaattgct
acgttgcaacaaagttatcttacagttaaacaagcttggattgaatctataggaaatggc
acgccgactatgaatatcggacgtttgatgagtgaaatgcattctataaataaattaata
gagaaccgtaataaaattagaggtgagctaaggcagatagtctctgatcctcagcgtatg
cctgcaactaaatttttaatttcacagcaaaccttaccagatgaaatcaaggtgcaaata
agatga

DBGET integrated database retrieval system