KEGG   Vibrio cholerae M66-2: VCM66_1534Help
Entry
VCM66_1534        CDS       T00891                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
vcm  Vibrio cholerae M66-2
Pathway
vcm00010  Glycolysis / Gluconeogenesis
vcm00052  Galactose metabolism
vcm01100  Metabolic pathways
vcm01110  Biosynthesis of secondary metabolites
vcm01120  Microbial metabolism in diverse environments
vcm01130  Biosynthesis of antibiotics
Module
vcm_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCM66_1534 (galM)
   00052 Galactose metabolism
    VCM66_1534 (galM)
Enzymes [BR:vcm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     VCM66_1534 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACP05847
UniProt: C3LMS1
Position
I:complement(1653742..1654794)
Genome map
AA seq 350 aa AA seqDB search
MNALFTSMTAQVAYDGQPAKLIELTNRRGMRVVVMDIGATWLSCTLPMGDESREVLLGVS
SMDDFVRQGSYLGATVGRYANRIARGELKIGTQTYALSVNQAGNTLHGGVVGFDRRRWQI
TQQSAQHVTFQLLSADGEQGFPGNLHVAVTYRLDEQGGVNIDYQATTDRATAVNLTNHAY
FNLNGAEQGSDCLNHQLWIDAKQFLPTDASGIPLGELQSVLGSGFDFTQPKRVGEDLLQD
KQQIRAKGYDHSYFFAPERDMHTPIAKVWSADEKVQLLVSTDKPAMQLYTGNWLAGTPNR
LGSHYKDYAGLALETQFLPDSPHHPEWLQPSCILQPGEVYRYQTRYQFVF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgttattcaccagcatgacagcacaggtcgcctatgatggtcagcctgccaag
cttattgagctcactaaccgccgcggtatgcgtgtggtagtgatggacatcggtgccact
tggctcagttgcactctaccgatgggcgatgaatcaagagaagtgctacttggcgtaagc
agcatggatgattttgtgcgccaaggcagttatttaggcgcaacggtggggcgttatgcc
aatcggattgcgcgtggcgaactcaagatagggacacaaacgtatgctttgtcggtcaat
caagctggcaatacgttacacggtggcgttgtagggtttgatcgtcgtcgctggcaaatc
acgcagcaaagcgcacagcatgtgacctttcaactgctttctgctgacggagaacaaggc
tttccgggcaacctccacgttgcagtgacctaccggttggatgagcaaggtggggtgaat
atcgactaccaagccaccaccgatcgtgcgaccgccgtgaatctaacgaaccacgcctac
tttaatttgaatggcgctgagcaaggtagtgattgcctcaatcatcagctctggattgat
gcaaagcagttcttaccaacggatgcctcgggtatcccgctcggggagttgcaatcggta
ctgggtagcggttttgatttcactcaaccgaaaagggttggggaggatttgcttcaagat
aaacagcaaatccgtgcgaaaggctatgaccacagttatttctttgcgccagagcgagat
atgcacacgcctatcgctaaggtgtggtctgccgatgagaaagtgcaactgctcgtcagt
acggataaacctgctatgcagctttataccggtaattggttggcgggaacacccaatcgc
cttggttcgcactacaaggattacgctggcctcgctttagaaacgcagtttttacccgat
tcccctcatcatccagaatggctgcaaccgagctgcatcctgcaacccggagaagtctat
cgctatcaaacgcgctatcagtttgttttttaa

DBGET integrated database retrieval system