KEGG   Vibrio cholerae M66-2: VCM66_1957Help
Entry
VCM66_1957        CDS       T00891                                 

Gene name
adhE
Definition
(GenBank) alcohol dehydrogenase/acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
vcm  Vibrio cholerae M66-2
Pathway
vcm00010  Glycolysis / Gluconeogenesis
vcm00071  Fatty acid degradation
vcm00350  Tyrosine metabolism
vcm00620  Pyruvate metabolism
vcm00625  Chloroalkane and chloroalkene degradation
vcm00626  Naphthalene degradation
vcm00650  Butanoate metabolism
vcm01100  Metabolic pathways
vcm01110  Biosynthesis of secondary metabolites
vcm01120  Microbial metabolism in diverse environments
vcm01130  Biosynthesis of antibiotics
vcm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VCM66_1957 (adhE)
   00620 Pyruvate metabolism
    VCM66_1957 (adhE)
   00650 Butanoate metabolism
    VCM66_1957 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    VCM66_1957 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    VCM66_1957 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VCM66_1957 (adhE)
   00626 Naphthalene degradation
    VCM66_1957 (adhE)
Enzymes [BR:vcm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VCM66_1957 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VCM66_1957 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 CbiG_N
Motif
Other DBs
NCBI-ProteinID: ACP06260
UniProt: C3LNY4
Position
I:complement(2124637..2127321)
Genome map
AA seq 894 aa AA seqDB search
MPVTNLAELDALVARVKAAQAEFATFSQEQVDKIFRAASLAANQARIPLAQMAVEESGMG
IVEDKVIKNHFASEFIYNKYKDEKTCGILEEDDNLGTMTIAEPVGIICGIVPTTNPTSTA
IFKSLISLKTRNGIIFSPHPRAKNSTNAAAKLVLDAAIAAGAPKDIIGWIDQPSVELSNA
LMKHDGIALILATGGPGMVKAAYSSGKPAIGVGAGNVPVVIDETADIKRAVASILMSKTF
DNGVVCASEQAAIVVSEVYDEVKERFATHKAHVLSKADADKVRKVLLIDGALNAKIVGQP
AAAIAEMAGVKVPADTKVLVGEGLGKVSYDDEFAHEKLSPTLGLFRADNFEDAVAQAVTM
VEIGGIGHTSGLYTNQDVNADRIRYFGDKLKTARILVNIPTTHGGIGDLYNFNVAPSLTL
GCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALSDLEGKKR
AFLVTDRFLFNNGYADDVVALLKAQGMEVQTFFEVEADPTLSVVEKGAAAMQSFQPDVIL
ALGGGSPMDAAKIMWVMYEHPDTHFEELAMRFMDIRKRIYKFPKMGKKAELVCITTTSGT
GSEVTPFAVVTDDKTGAKYPLADYELTPQMAIVDANLVMNMPKSLTAFGGYDAVTHALEA
YVSVLANEYSDGQALQALKMLKEYLPSSYANGAKDPIAREKVHNAATIAGIAFANAFLGV
CHSMAHKIGAEFHLPHGLANALLIANVVRYNANDNPTKQTAFSQYDRPQARRRYAEVADH
LGLSQPGDRTAQKIERLLTWLDELKVNLDIPKSIQAAGVAEADFLAKVDELAVEAFDDQC
TGANPRYPLIAELKEVLLASYYGKPFVEGQTFEGTTVIVKKADQEAAKAPKAKK
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttactaatctggctgaacttgatgctctggttgctcgcgttaaagcagctcaa
gctgaatttgctactttctctcaagaacaagtagacaaaatcttccgcgcagcctctcta
gcagcaaaccaagcacgtatcccgttagcacaaatggcggtagaagaatcaggtatgggt
attgttgaagataaagtaatcaaaaaccactttgcttctgagtttatctacaacaagtac
aaggacgaaaaaacctgtggcatcctcgaagaagatgacaacctaggtactatgactatc
gctgagcctgttggcatcatctgtggtatcgtcccaacgactaacccaacctcaaccgcg
atcttcaaatcactgatttctctgaagactcgtaacggtatcatcttctctccacaccca
cgtgcgaaaaactcaaccaacgcagcagcgaaactggttctggatgccgcaatcgcagcg
ggtgcaccaaaagacatcatcggttggattgaccaaccttcagttgagctgtcaaatgct
ctgatgaaacacgatggtatcgcactgatccttgcgacgggtggtcctgggatggtgaaa
gcggcttactcttctggtaaaccagccatcggtgtaggtgcaggtaacgttccagttgtt
atcgatgaaactgcagatatcaaacgtgcggttgcttctatcctgatgtctaaaacgttc
gacaacggtgtagtgtgtgcttctgagcaagcggctatcgtagtgagcgaagtttacgac
gaagtgaaagagcgtttcgcaacgcacaaagcgcacgtcctgagcaaagcggatgcagac
aaagtgcgtaaagtgctgctgattgatggcgctctgaacgcgaagatcgtaggtcaacct
gctgctgctatcgctgaaatggcaggcgtaaaagtacctgcagatactaaagtgctggtg
ggtgaaggtctgggcaaagtctcttatgacgatgaattcgctcacgagaaactgtctcca
acacttggcctgttccgtgctgacaacttcgaagacgcggttgctcaagcggtgactatg
gttgagatcggcggtatcggtcacacctcaggtctgtacaccaaccaagacgttaacgca
gaccgtatccgttactttggtgataaactgaaaactgcccgtattcttgtcaacatcccg
accactcacggtggtatcggtgatctgtacaacttcaacgttgcaccgtctctgactctg
ggttgtggttcttggggtggtaactcaatctctgagaacgtaggtcctaagcacctaatc
aacaagaaaactgttgcgaagcgagctgaaaacatgttgtggcacaaactacctaagtct
atctacttccgccgtggtagccttccaatcgccctgagcgacctagaaggtaaaaaacgc
gcattcctagttactgaccgtttcctattcaacaacggttatgcagacgatgtggttgcc
ctgctgaaagcacaaggcatggaagttcagacattcttcgaagtagaagcggatccaaca
ctgtctgtcgtagaaaaaggcgctgcagcaatgcaaagcttccaaccagatgtgattctt
gcgctaggtggtggttcaccaatggatgcggcgaagatcatgtgggtaatgtacgagcac
ccagatactcactttgaagaactggctatgcgctttatggacatccgtaagcgtatctac
aagttccctaaaatgggtaaaaaagcagagcttgtttgtatcactaccacttcaggtacg
gggtcagaagttacaccattcgcggttgtgactgacgacaagactggcgctaagtaccca
ctggcagactacgaactgacaccacaaatggcgatcgtagatgcgaaccttgtgatgaac
atgcctaagtctctgaccgctttcggtggttacgatgcggtaactcacgcactcgaagct
tatgtatccgttcttgcgaacgaatactcagacggtcaagcactacaagcgctgaagatg
ctgaaagagtacctaccttctagctacgcgaatggtgcgaaagatccaatcgctcgtgag
aaagtacacaacgcagccactatcgctggtatcgcattcgcgaacgcgttcttgggtgta
tgtcactcaatggcgcacaaaatcggtgctgagttccacctaccacacggtttggcgaac
gctctgctgattgctaacgtagtacgttacaacgcgaacgacaacccaaccaaacaaacg
gcattctctcaatacgaccgtccacaagcacgtcgtcgttacgcagaagtggcggaccac
ttaggtctgagccaaccgggtgaccgtactgcacagaagattgagcgtctgctgacttgg
ttggatgaactgaaagttaacctagacattccaaaatcaatccaagctgcaggtgtagca
gaagcagacttccttgcaaaagtggatgagctagcggttgaagcgtttgatgaccaatgt
actggtgcaaacccacgctacccactgatcgctgagctgaaagaagttctgctggcttct
tactacggtaagccattcgttgaaggtcaaactttcgaaggcaccactgttatcgtaaag
aaagcagatcaagaagcggcgaaagcgccaaaagcgaaaaagtaa

DBGET integrated database retrieval system