KEGG   Vibrio cholerae M66-2: VCM66_2285Help
Entry
VCM66_2285        CDS       T00891                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
vcm  Vibrio cholerae M66-2
Pathway
vcm00260  Glycine, serine and threonine metabolism
vcm00750  Vitamin B6 metabolism
vcm01100  Metabolic pathways
vcm01110  Biosynthesis of secondary metabolites
vcm01120  Microbial metabolism in diverse environments
vcm01230  Biosynthesis of amino acids
Module
vcm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vcm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VCM66_2285 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VCM66_2285 (thrC)
Enzymes [BR:vcm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VCM66_2285 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ACP06586
UniProt: C3LQD4
Position
I:complement(2454613..2455893)
Genome map
AA seq 426 aa AA seqDB search
MKLYNIKENDEQVSFGQAVRQGLGRNQGLFFPAQLPKFDDIDALLAEDFVSRSSKILSAL
IGDELPADKIRAMVDSAFQFAAPIAKVKEGVYALELFHGPTLAFKDFGGRFMAQSLAAVS
NGGKITILTATSGDTGAAVAHAFYGMPDINVVILYPKGKISPLQEKLFCTLGKNIHTVAI
NGDFDACQALVKQAFDDAELRQQIGLNSANSINISRLMAQICYYFEAAAQMSKAERENLV
ISVPSGNFGNLTAGLLAKALGLPVKRFIAATNANDTVPRYLETGRWEPKPTVATTSNAMD
VSQPNNWPRIEELCQRMGWGLETLGKGAVSDEESAQAVQELYDLGYLCEPHGSIAYRVLE
EQRQPQETGLFLCTAHPAKFKEVVDDILGTDIALPAPLAKHAAMELLSQELNADFAALRA
LLVNVK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtacaacataaaagaaaatgatgaacaagtctcctttggtcaagccgttcgc
caagggttaggccgcaatcaaggcctgttttttccggcacaattgccgaagtttgacgat
attgatgctctattggccgaagatttcgtctctcgtagcagcaagattttatcggcgttg
attggcgatgaactgcctgcggataaaattcgcgctatggtggattccgcctttcaattc
gccgcaccgattgccaaagtgaaagagggcgtttacgcgctcgaattgttccacgggcca
acgctcgcgtttaaagattttggtggtcgctttatggcccagtctctggcggcggtctcg
aacggcggaaaaatcacgattttgacggcgacatccggtgataccggcgctgctgttgcg
cacgcattttatggtatgccagacattaatgtggtgatcctttatccgaaaggaaaaatc
agtccgctgcaagaaaagctgttctgcacattaggtaaaaacattcacaccgtggcgatc
aatggcgattttgatgcttgccaagcactagtgaaacaagcttttgatgacgcagagctg
cgccaacagataggtttgaactctgccaactcaattaacatcagccgtttgatggcacaa
atctgttactactttgaagccgctgcgcagatgagcaaagctgagcgtgaaaatctggtg
atttcagtgcctagtggcaactttggtaacttaaccgcagggctgttagccaaagcactg
ggtttaccggtgaagcgctttattgcggcaaccaatgccaacgatacagtgccacgttac
ttggaaacgggacgttgggaacccaaacccacggtagcaacaacgtcaaatgcgatggat
gtcagccaaccgaacaactggccgcgtatcgaagagctctgccaacgtatgggatggggc
ttagaaacgctgggcaaaggcgcggtttctgacgaggaaagtgcgcaagccgtacaagaa
ctttacgatctaggctacttgtgtgaaccgcatggttcgattgcttaccgtgtattggaa
gagcagcgccagccgcaagaaacggggctgttcttatgtaccgcgcatcccgccaaattc
aaagaagtggtggacgatattttaggtaccgacattgctctaccagcgccattggcaaaa
catgcggcgatggaattgctctcacaagagctgaatgccgatttcgcagcgctgcgtgcg
ttactggtgaatgtgaaataa

DBGET integrated database retrieval system