KEGG   Vibrio cholerae O1 M66-2: VCM66_A0016
Entry
VCM66_A0016       CDS       T00891                                 

Gene name
hcp-2
Definition
(GenBank) hcp protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VCM66_A0016 (hcp-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcm02044]
    VCM66_A0016 (hcp-2)
Secretion system [BR:vcm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCM66_A0016 (hcp-2)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACP07001
UniProt: C3LMB0
Structure
PDB: 
5MXN

Position
II:19766..20284
AA seq 172 aa
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPS
GQRVHKPFKFTVALNKAVPLLYNALSSGEKLKTVELKWYRTSIEGKQENFFTTKLENASI
VDIHCEMPHCQDPAKSDFTQNVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgttatatctctatcgaaggccaaactcagggtcttatcactgcaggc
gcatgtactgctgactctatcggcgattcattcgttgaaggccatgaagatgagatgctg
gttcagcagtttgaccacgtcgtaaccgtaccgactgacccacaatctggtcagccttcc
ggccaacgtgtgcacaagccattcaaattcactgtggcgctgaacaaagcggttcctctg
ctgtacaacgcgctctcttcaggtgagaagctgaaaaccgttgagctgaaatggtaccgt
acttctatcgaaggcaaacaagaaaacttcttcaccactaagctggaaaacgcgtctatc
gttgatatccactgtgaaatgccacactgccaagacccagcaaaatctgactttactcag
aatgtgactgtgtctctgtcttaccgcaaaatcacttgggaccacgttaacgcgggcacc
tcaggctctgatgactggcgtaagccaatcgaagcgtaa

DBGET integrated database retrieval system