KEGG   Vibrio cholerae O1 M66-2: VCM66_A0105
Entry
VCM66_A0105       CDS       T00891                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
vcm  Vibrio cholerae O1 M66-2
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcm02044]
    VCM66_A0105
Secretion system [BR:vcm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCM66_A0105
SSDB
Motif
Pfam: T6SS_VipA BACON
Other DBs
NCBI-ProteinID: ACP07086
UniProt: C3LUD1
Structure
PDB: 
5MXN 5MYU

Position
II:116837..117343
AA seq 168 aa
MSKEGSVAPKERINIKYIPATGDAQAEVELPLKTLVVGDFKGHAEQTPLEERATVTVDKN
NFEAVMRESELKITATVKNKLTDDENAELPVELNFKSLADFAPDAVASQVPELKKLIELR
EALVALKGPLGNIPAFRERLQSLLNSEESREKLLAELNLLSGQEEPQA
NT seq 507 nt   +upstreamnt  +downstreamnt
atgtctaaagaaggaagtgtagctcccaaagagcggattaatatcaagtatattccggcg
acgggggatgcacaggctgaggttgagctaccactcaaaaccctagttgtaggtgatttc
aaagggcatgcggagcaaaccccattggaagagcgtgcaacagtcacggtagataagaac
aactttgaagccgtaatgcgcgagagcgagctgaaaatcaccgccacggtgaaaaacaag
ctgactgatgatgagaatgccgagcttcctgttgaactcaatttcaaatccttagccgac
ttcgctcctgatgcggtggcatcacaagttccagaactgaaaaaattgattgagttgcgt
gaagcgttagttgcccttaaagggccgctaggcaacattcccgcatttcgtgagcgttta
cagtcattactcaactcagaagagtcgagagaaaagctgttggcagaactgaatctgctc
agtggtcaagaagagccacaagcgtaa

DBGET integrated database retrieval system