KEGG   Vibrio cholerae O1 M66-2: VCM66_A0107
Entry
VCM66_A0107       CDS       T00891                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
vcm  Vibrio cholerae O1 M66-2
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcm02044]
    VCM66_A0107
Secretion system [BR:vcm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCM66_A0107
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ACP07088
UniProt: C3LUD3
Position
II:118865..119302
AA seq 145 aa
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAP
HLGLVDFNDATLETLDLSVRIKLAIQQCLERYEPRLTRVLVRADQDSFNPLTLRFHITAT
INSEALHEKVQFSLLLDQSRKYRVF
NT seq 438 nt   +upstreamnt  +downstreamnt
atgacgtacatcgcacctgaagagagtgcatttggtgttggctttttcgaacgtttggaa
gccaacgccaaacctatgtcgctgacccgtgggccagacgcgtgggatgtactcgaatcg
atcaaacggaatgtctctaacattctgaacactcgaattggtggagcgcaaagtgcccct
catctcgggttggtggattttaatgatgcaacgctggaaaccttagatctctccgtgcga
attaaattggcgattcaacagtgccttgagcgctatgagccgcgtttaactcgcgttctg
gtgagagcggatcaagatagctttaacccgctgactttaaggttccacattaccgcgacc
atcaatagcgaagcgttacacgaaaaagtccagttcagtctgttattggatcaaagcaga
aaatatcgagtgttttaa

DBGET integrated database retrieval system