KEGG   Vibrio cholerae O1 M66-2: VCM66_A0111
Entry
VCM66_A0111       CDS       T00891                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VCM66_A0111
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcm02044]
    VCM66_A0111
Secretion system [BR:vcm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCM66_A0111
SSDB
Motif
Pfam: T6SS-SciN LPAM_1
Other DBs
NCBI-ProteinID: ACP07092
UniProt: C3LUD7
Position
II:123550..124026
AA seq 158 aa
MNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFEL
KDDSMFMSSDYDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHF
AEPELSEWKKAVKVINKGREYHLLMLFKDYDVKLDRVE
NT seq 477 nt   +upstreamnt  +downstreamnt
gtgaacaaagtgctgtggatgctgtttgccttgacggtactgaccgcgtgcagttcgtcg
gataagtacgagcctgcgaaagagccgaccaaggtgacttttagcttagtcagcgatgaa
ggggtgaacccgaacatctggggtgaagcgtcaccgatagaaattcaagtttttgagcta
aaggatgactcgatgtttatgtcgtccgactacgaccagatcaaaaccgattataaaaaa
gcgctgcgcagtaactttgttaaaaactacgactatgtactgactccagggcagttcaaa
ttcgtcaacgctttcgaagtcgatgaggagaccaactacatcggcgtgatggctcatttt
gccgagcctgaactcagcgaatggaagaaagcggtcaaggtgatcaataaagggcgagag
tatcacttgctgatgctgtttaaagactacgatgtgaaattggatagggtggaataa

DBGET integrated database retrieval system