KEGG   Vibrio cholerae O1 M66-2: VCM66_A0113
Entry
VCM66_A0113       CDS       T00891                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VCM66_A0113
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcm02044]
    VCM66_A0113
Secretion system [BR:vcm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCM66_A0113
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ACP07094
UniProt: C3LUD9
Structure
PDB: 
4V3I

Position
II:125370..126143
AA seq 257 aa
MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECD
NIEQIYRQTIEEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHS
MLSRFHNETWGGEKVFTILSRLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREK
VISRLHQLLSSLEESEPQDLTRPTDHVVRAKYTLSRQMPVWSVFAGFIVLWVGLFLGYSY
VLHSKSSDVLNQLNQIL
NT seq 774 nt   +upstreamnt  +downstreamnt
atgtcacagagtaaaaaagagacgccattagccagtttgttgttcgacgatgtggaaaaa
attaaccacgaccaagactactggttccaattgcgtggggacaatccgaatgtgctgatt
gatgccgcgacacccttgtttgggctttctctgcgggttcgtaccctcaccgaatgcgac
aacattgaacagatctaccgtcagacgattgaagagatcaaagcgattgaaattgagttg
acggagcaaggttacgaacacgccattttgatggcctatcgctacatcttgtgcgccttt
ttggatgaatccgtgatgggaaccgagtggggcgcgtccagtttatgggccgagcactcc
atgctgtcacgcttccataatgaaacgtggggtggcgagaaagtgtttacgattttgagc
cgtcttgagggtgaaccacaccgttaccaagcgctattggcctttatttatcattgcctg
attttgggctttgaaggcaaataccgtgtgatggaagggggacaagctgagcgcgaaaaa
gtgatcagccgcctgcatcaactgctgagcagcttggaagagagcgagccacaagactta
acccgtccgaccgatcatgtggtgcgtgcgaaatataccctaagcagacagatgcctgtt
tggtctgtgtttgctggctttatcgtgctttgggtaggtctatttctcggctacagctat
gtactgcatagcaaatccagcgatgtgctcaatcaactcaatcaaatactttaa

DBGET integrated database retrieval system