KEGG   Vibrio cholerae O1 M66-2: VCM66_A0115
Entry
VCM66_A0115       CDS       T00891                                 

Definition
(GenBank) sigma-54 dependent transcriptional regulator
  KO
K11908  sigma-54 dependent transcriptional regulator
Organism
vcm  Vibrio cholerae O1 M66-2
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vcm03000]
    VCM66_A0115
Transcription factors [BR:vcm03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    VCM66_A0115
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 AAA_5 HTH_8 Mg_chelatase AAA_2 AAA DUF2381 AAA_16 TIP49
Other DBs
NCBI-ProteinID: ACP07096
UniProt: C3LUE1
Position
II:128781..130373
AA seq 530 aa
MSQWLAFATQLVGVRKSHQLALQFVDLLTQGLDLSDSLLLLPSSDGRLLVPHDPQRQFAW
SVTDFDVPFAHVLQSSNAMHLTAEELVFWQSNRTFSQLTSRVGMFDSVWIQPLPMDTRQV
HSILLLMGESHGIVSAFENADFLKFIEVFSQQWSLLNDMEREEQRRLELKQSLTDIERDS
AQRSLANALSRTLIGESAAMQKLREQIVSAANSQLSVMVQGETGTGKELVAAAVHELSSR
KSAPFVAINCAAIPEHLLESELFGYCKGAFSGADSDKQGLIAQANGGTLFLDEIGDMPLT
LQAKLLRVLESRTFRPLGGKQELSSDFRLVSATHVNLLDQVRKKEFRQDLYYRLFQYPIT
LPRLAARLEDIELLSEHFVRVFNLQHNTRIRGLNYRAIDCLKQYDFPGNVRELKHLIEFG
CAQTADGTQVEASCFAHRLQTLPCLAPEATPVAVSVETENVDLEPSVALAGEPNFAVIHD
LKQAVSQFEALIISERLNRFAGDRAKAAKSLGIPKRTLAYKCLKLEIKTP
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgagtcaatggctggcgtttgcaacccaattggtgggagtaaggaagtcccaccagctt
gcgctgcaatttgttgatctgctgactcaaggcttagatctgagtgatagccttttgttg
ttgccatcgtcggatgggcgtttacttgtgcctcatgatccacagcgtcagttcgcgtgg
tcagtgacggattttgatgtgccttttgcccatgttttgcagtcatccaatgcgatgcat
ttgaccgcggaagagttggtattttggcaatccaatcgcacttttagccagttaacctct
cgcgtggggatgtttgattcggtatggatccaacccctgccgatggatactcgtcaagta
cactcgatcttgctgttgatgggcgagagtcacggtatcgtgagcgcttttgaaaacgcg
gactttttgaagtttatcgaggttttttcccagcaatggtcactgctcaacgatatggaa
cgtgaagagcagcgccgcttggagctgaaacaatcgctgacggatattgaacgcgactcg
gcgcagcgctcactggccaatgcgttatcgcgtactttgattggtgaaagcgctgcgatg
caaaagctgcgtgagcagattgtctctgccgctaactctcagctctcggtcatggtgcaa
ggtgaaactggcacggggaaagagttagtcgccgcggccgtgcatgaactttcgtcacgt
aagtctgcgccgtttgttgcgatcaactgtgcggcgatccctgagcatctactggaaagt
gaactgtttggttactgcaaaggggcattttctggagcggacagcgataaacagggactt
atcgcacaagcgaatggtggcacgctatttctggatgagatcggcgatatgccgctcacc
ttacaagccaaattattgcgtgtgcttgaatcgcgtacttttcgaccgctcggtggtaag
caggagctcagttccgatttccgtctggtatctgccacacacgtcaatctgctggatcaa
gtacgcaaaaaagaatttcgccaagatctctattaccgtctattccagtatccgatcacc
ttgccgcgtttggcggcacgcttggaagatattgagctgctcagtgagcactttgtgcgc
gtgttcaacttgcaacataacacgcgcattcgtggtttgaactatcgagccatcgactgc
cttaagcagtacgacttcccgggaaatgtgcgtgagctgaaacatttgattgagtttggc
tgcgcgcaaacagcggatggtacgcaggtggaagctagttgctttgcccatcgtttacaa
accctaccctgtcttgcgcctgaagcgacgccggtagccgtttctgtcgaaactgagaac
gtggatcttgaaccctcggttgcgctggctggagaaccgaattttgcggttatccatgat
ttgaaacaggcggtcagtcagtttgaagcgttgatcatcagtgagcgtttgaaccgcttt
gctggcgatcgcgcgaaagcggcgaaaagtctcggtatccctaagcgtaccttggcctac
aagtgcctgaaattggagatcaaaaccccatga

DBGET integrated database retrieval system