KEGG   Vibrio cholerae O1 M66-2: VCM66_A0117
Entry
VCM66_A0117       CDS       T00891                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
vcm  Vibrio cholerae O1 M66-2
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcm02044]
    VCM66_A0117
Secretion system [BR:vcm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCM66_A0117
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N Dpoe2NT
Other DBs
NCBI-ProteinID: ACP07098
UniProt: C3LUE3
Structure
PDB: 
6RIU

Position
II:131036..132445
AA seq 469 aa
MEMTEYRQCVAKPISSSNPVGERLVDHPLFDFIEDQMMKVGSLSHASVQWDEVEHSTLKL
LGEQSKDIKLLVYLLQCLHNQVTPTRLITSFAVMSEFLNQYWNDSYPAPGPRGNLPRRKF
FSQMAQRFTTVIEKFDFHHLDEADRQALQAAVEEWQQAVEKQGLSSELVESVVVRITAEI
KRAEQRQQVTAQSSAERETPSAATPSPAASMVVDHSSDKAAKQTLLKVADFLAEQEFGIA
LSIRLRRFAVWGSITSLPDHKPDGETLLRGMQADRVKDYQDQLRHPDLALWRKVEQSLTM
APYWFEGQWMSYTIAQQLGKSDWCQAIAEETQQFLRRLPSLLELKFKGGEPFVSDSVKEW
LASVGQSQGAAGQSVGGDWQEKRKEAFQLAKEGGIAVALSMLNDGLVSAVEPRDKFYWRL
LSADLLRANHLDAMAGEQYQTLLNQVTTLSVPEWEPSLVEQIQRYTTSE
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggaaatgactgaataccgtcagtgtgtggccaaaccgatcagcagtagcaatcctgtc
ggagagcggctagtcgatcacccactgtttgattttattgaggatcagatgatgaaagtg
ggctctctctctcacgcttcagtgcagtgggatgaagtggagcacagcactctcaaactg
cttggtgaacagagtaaagacatcaagcttttggtttacctgctgcagtgtctgcataac
caagttaccccgacgcgccttattacctcgtttgcggtgatgagtgagttcctcaatcaa
tattggaacgacagttatccagcgccgggcccacgtggcaatctgccgcgacgtaaattt
ttcagccagatggcgcaacgttttaccacggtgatcgaaaagttcgattttcatcatctg
gatgaagcggatcgccaagcgctacaagcggcggttgaagagtggcaacaagccgttgag
aaacaagggctctcttctgagttggtggagtctgtggtggtgcgaattaccgcggagatc
aaacgcgcagagcagcgccagcaagtgacggcgcaaagcagcgcggagcgtgaaacacca
agtgctgcaacgccttctcctgcggcgagtatggtggtggatcattcgagtgacaaagca
gcgaaacaaaccctactcaaagtggcagattttcttgccgaacaagagtttggtatcgct
ctttcgattcgtctgcgccgctttgcggtgtggggcagcattacctcattgcccgatcat
aaacccgatggtgaaacactgctgcgtggaatgcaggcggatcgcgtcaaggattaccaa
gatcaacttcgtcaccccgatttagccttgtggcgcaaagtcgaacagagcttaaccatg
gctccttattggtttgaaggacagtggatgagttacaccattgcccagcaactcggcaaa
agtgattggtgtcaggcgattgccgaagaaacacaacagtttttacgtcgtttgccttcg
ctgcttgagctcaaattcaaaggcggagagccgtttgtcagcgattcggtcaaagagtgg
ctggcgagcgtaggtcagagccaaggtgctgcggggcaatcggtcggcggagattggcaa
gagaagcgtaaagaggcgtttcaactggctaaagaaggtggaatcgcggtggcactttcc
atgctcaatgatggcttggtcagtgcggtggagccgcgagacaaattttactggcgattg
ctatcggcagatctgctgcgggcaaatcatctcgatgcgatggctggtgaacagtatcaa
actctgctcaatcaggtaacgacgctgtctgttcctgagtgggaaccgagtttagtggaa
caaattcaaagatatacaacgtcagagtaa

DBGET integrated database retrieval system