KEGG   Vibrio cholerae O1 M66-2: VCM66_A0119
Entry
VCM66_A0119       CDS       T00891                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11911  type VI secretion system protein VasL
Organism
vcm  Vibrio cholerae O1 M66-2
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcm02044]
    VCM66_A0119
Secretion system [BR:vcm02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VCM66_A0119
SSDB
Motif
Pfam: ImpA_N Cytochrom_B562 DUF1640
Other DBs
NCBI-ProteinID: ACP07100
UniProt: C3LUE5
Position
II:136054..137319
AA seq 421 aa
MMSNVIFIDNVCYRLTNDSEEIRGLEPYAKVREEINRRFNPIAGGTDWAVVKEYCEQLAC
NQGMDFLICGYYAVACLKTQGLAGYATGMELMSASLANQGECDVKSAKVRKEILDWVNAR
VVQELKALKPTYESLRDLYRAERHCERLHQLFEQQQTEYKVDFEGVGFALFEHIDRIETQ
YHSLLKKQEKAQPPKLKFWQRGYALFTLGVLGVALGMVGGYWGWPWFYTTPYAAPQRITT
LNEASQTQALLNDSSTSERARWQHDLIPLYRDTLQQNLTISFSEPKRHAITQLNLLRTLY
PENEQVNALSQEFALQQQQALEQTALFVAKFSEIRTKMANISLLAKRGKWAELEKQTKSL
EEFAVSLSPIYGRVDYVQGLLEQGDVTNAQKEFAILKQRLDSLSWKIAELEQRIGDAALL
Q
NT seq 1266 nt   +upstreamnt  +downstreamnt
gtgatgtccaatgtgatttttattgataacgtttgctaccgattaaccaatgattctgag
gagattcgcggattagagccctatgcgaaggttcgtgaggagataaaccgccgcttcaat
ccgattgctgggggcacggattgggcagtggtaaaagagtactgtgaacaactggcctgt
aaccaaggaatggattttctgatctgcggttactatgcggtagcctgcctgaaaactcag
gggttagcggggtatgccaccggtatggagctgatgagtgcaagccttgccaaccaaggt
gagtgtgatgtgaaaagcgccaaagtgcgcaaagagatccttgattgggtcaatgcacgt
gtggtgcaggaactgaaagcacttaagccaacttatgagtcgctgcgagatctgtatcgg
gctgagcgccattgcgagcggttacatcagctgtttgaacagcaacaaaccgaatacaaa
gtagactttgaaggggtcgggtttgctctgtttgaacacatagacagaattgaaacccaa
taccacagcttattgaaaaagcaggagaaggctcagccacctaagcttaagttttggcag
cgcggttacgcgttgttcactctaggtgtactcggggttgcactgggaatggtggggggc
tactgggggtggccttggttttataccacgccttatgccgcgccacagcgcatcactacg
ttgaatgaggcctctcaaactcaagcactgctcaacgactcttccacaagtgagcgtgcg
cgttggcaacatgatctgatcccgctgtatcgcgatactttgcagcagaatttaaccatc
tcgtttagtgaacctaagcgacatgccatcactcagctgaatctattgcgcactctttat
cctgaaaacgagcaagtgaatgcactgagtcaagagtttgcccttcagcagcaacaagcg
ttggagcaaaccgcgctgttcgtggctaagttcagcgaaattcgcaccaaaatggccaat
atctcgttattggctaagcgagggaaatgggctgagttagaaaagcagaccaaatcatta
gaagagttcgcggtcagcctatcaccgatttatggtcgagttgactatgtgcaaggcctc
cttgaacagggcgatgtcacaaatgcccagaaagagtttgcgatcctcaaacaaaggcta
gatagcctaagttggaaaattgccgagcttgagcagcgtatcggcgatgcggctttgttg
cagtga

DBGET integrated database retrieval system