KEGG   Vibrio cholerae O1 M66-2: VCM66_A0572Help
Entry
VCM66_A0572       CDS       T00891                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm00670  One carbon pool by folate
vcm01100  Metabolic pathways
vcm01120  Microbial metabolism in diverse environments
vcm01200  Carbon metabolism
Module
vcm_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    VCM66_A0572 (fhs)
Enzymes [BR:vcm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     VCM66_A0572 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: ACP07534
UniProt: C3LVM9
Position
II:522043..523842
Genome map
AA seq 599 aa AA seqDB search
MRANVFLTIFTALDEGFMLPDIEICRATPLAPIDTIAQKAGLHANEYESHGQHKAKVSLH
CLERLANKPKGKFILVTAITPTPLGEGKTVTTIGLAQGLAKLNHSVMACIRQPSMGPIFG
VKGGAAGGGYSQVAPMEELNLHLTGDIHAVTAAHNLAAAAIDARIYHEQRLGYADFERRT
GMPALRIDPKQVIWKRVMDHNDRALRMVTVGRNEPGKNINGYEREDGFDISAASELMAIL
ALASDLRDLRRRIGNVVLAYDLDGNPVTTEDLKVAGAMAVSMKEAIEPTLMQTLEGVPTL
IHAGPFANIAHGNSSIIADEIATRLADYTVTEGGFGSDMGFEKACNIKAKASGKTPDCAV
IVATLRGLKANSGLYDLRPGQAVPDALFAPDSAALQAGFANLKWHIDNVNQYGVPAVVAI
NRFPQDCAEELEQLVKLIEALPNRVSVAISEGFAKGGEGTKLLAEKVVEQCQHPTKFTPL
YDSGIPLDEKLKAVAVKGYGAAEIALSDKAAQQLAKLQTQGFDHLAVCLAKTPLSISTDP
AIKGAPRDFIVPIRELRLCAGAEFVYALCGSVMTMPGLPEKPSFMALDIDQHGNIVGLS
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgcaaacgttttcctcaccatttttaccgctctagatgagggttttatgctgcca
gatattgaaatttgccgcgctacaccattagcgcctatcgacaccattgctcaaaaagcg
ggattgcacgcgaatgagtacgaaagccacggccagcataaagccaaagtgtcactgcat
tgtctagagcgattggccaacaagcccaaaggtaaattcattctggtcactgcgattacc
ccaacaccactgggtgaaggtaaaaccgttaccacgattggtttagcacaagggttggcc
aaacttaatcactcggtcatggcgtgcattcgccagccttcgatggggccgatttttggg
gtaaaaggtggcgctgcgggtggtggttattcacaagttgcaccgatggaagagctcaat
ctgcatttaaccggtgatattcatgccgtcacggcggcgcacaaccttgcggcagctgcg
attgatgcgcgaatttatcacgagcagcgcctcggctatgcagattttgagcgccgcacc
ggcatgccagcgctgcgcattgaccccaaacaggtcatatggaaacgcgtgatggatcat
aacgatcgcgcgctgcgcatggtgacagtcggccgcaatgaaccgggaaaaaatattaat
ggttatgagcgcgaagatggtttcgatatctctgccgcctccgaattgatggcgattctg
gctctcgcctcggatctacgtgatttgcgtcgccgtatcggtaatgtggtgctggcttat
gatttggacggtaatccggtcaccaccgaagatctgaaagtggctggtgcaatggcagtc
agtatgaaagaagccattgagccgaccttgatgcaaactttagaaggcgtcccaacactg
atccacgccggcccatttgccaatatcgcgcacggtaactcctcgatcattgccgatgaa
atcgccacccgtttggcagactacaccgtgaccgaaggcggttttggctccgatatgggg
tttgagaaagcgtgcaacatcaaagccaaagcatccggtaaaaccccagattgtgcggtg
attgtcgccaccttacgcggcttaaaagccaactcaggcctgtatgatttacgccccggc
caagcggtaccggatgccctattcgcgccagacagcgccgctttgcaagccggttttgca
aacttgaaatggcatattgataacgttaaccagtatggtgtgcctgccgtggtagcgatt
aaccgcttcccacaagattgtgccgaagaactggaacaactggttaagctgattgaagcc
ctgcccaaccgtgtatcggtagccatttcagaaggctttgccaaaggcggtgaaggtacc
aagctgcttgccgaaaaagtggttgagcagtgtcaacatccaacgaaattcactccgctc
tacgattcaggcataccattggatgaaaaactcaaagcggtcgcggtaaaaggttatggc
gctgccgagattgctctgagtgataaagccgcacagcaattagccaaactgcaaacccaa
ggctttgaccatcttgcggtttgcttggcgaaaacaccgctgtcgatttctaccgatccc
gcaatcaaaggcgcgccacgtgattttatcgtaccgatccgcgagctgcgtttatgtgca
ggcgccgaatttgtttacgccctgtgtggcagtgtgatgaccatgcccggtttaccggaa
aaaccttcctttatggcgctcgatatcgatcagcacggcaacatcgtcggcttaagttaa

DBGET integrated database retrieval system