KEGG   Vibrio cholerae O1 M66-2: VCM66_A1017Help
Entry
VCM66_A1017       CDS       T00891                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K16317  tRNA (pseudouridine54-N1)-methyltransferase [EC:2.1.1.257]
Organism
vcm  Vibrio cholerae O1 M66-2
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vcm03016]
    VCM66_A1017
Enzymes [BR:vcm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.257  tRNA (pseudouridine54-N1)-methyltransferase
     VCM66_A1017
Transfer RNA biogenesis [BR:vcm03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    VCM66_A1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltrn_RNA_2
Motif
Other DBs
NCBI-ProteinID: ACP07976
UniProt: C3LWX1
Structure
PDB: 

Position
II:984064..984681
Genome map
AA seq 205 aa AA seqDB search
MRNTMRSFILRARSAPTDSQRLLDEIGGKCHTEILAHCMMNSLFTAQSHREDVVIHLVLE
STRDYSRTITVEANEISDVGGFHEAALIALLVKALDASVGMGKEQTRVVQPGLTVRTISF
EALLGELAEHHSLYMMDKKGDSIRDIKIGPNPCFILTDHIPMPKKSGNSMKRLGVEKISL
GPKMLFASQCVTLIHNEIDHQEAGW
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagaaataccatgcgcagttttatcctccgagctcgctccgcaccgaccgatagccaa
cgcctactggacgaaattggtggcaaatgccataccgaaattttggcacactgcatgatg
aacagcctgtttaccgcgcagtcgcatcgtgaagatgtggtgattcatctggtattggaa
agtacgcgcgattattcacgcaccatcaccgtcgaagcgaatgaaatcagtgatgtgggc
ggattccatgaagcggccttgattgccctgttggtgaaagcgctggatgcctcagttggc
atgggcaaagaacaaacgcgtgtggttcagccgggtttaaccgtgcgcaccatcagcttt
gaagcgctactcggtgagttggcggaacaccactcgttgtacatgatggataaaaaaggt
gattcaattcgtgatattaagattggcccgaacccgtgttttattttgaccgatcatatc
ccgatgccgaaaaagagtggtaactcgatgaaacgtcttggggtagaaaaaatcagcctt
gggccaaaaatgctgtttgcctctcaatgtgtcacgctaattcataacgagattgatcac
caagaagcagggtggtaa

DBGET integrated database retrieval system